Psyllid ID: psy10560

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MFHSGVCETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR
cccccccccccccccccccccccEEEEcccccccccccccccccccccEEEccEEEEccccccccccccccccc
ccccccccccccccccEcccccccccccccccccccccccccccccccEEcccEEEEccccccccccccccccc
MFHSGVCETQRAAHTYavshsghsegiqdsehtsltqplcdkdcgthghcvgdacvcnagwsgeycnlqqcdnr
mfhsgvceTQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR
MFHSGVCETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR
*************************************PLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQ*****
****G**ETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQC***
MFHSGVCETQRAAHTYA*****************LTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR
******CETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQ*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFHSGVCETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
O61307 2731 Teneurin-m OS=Drosophila no N/A 0.527 0.014 0.589 7e-08
Q9W7R4 2590 Teneurin-3 OS=Danio rerio yes N/A 0.486 0.013 0.472 0.0003
Q9R1K2 2774 Teneurin-2 OS=Rattus norv yes N/A 0.486 0.012 0.5 0.0005
Q9NT68 2774 Teneurin-2 OS=Homo sapien yes N/A 0.486 0.012 0.5 0.0005
Q9WTS5 2764 Teneurin-2 OS=Mus musculu yes N/A 0.486 0.013 0.5 0.0005
Q9DER5 2802 Teneurin-2 OS=Gallus gall yes N/A 0.486 0.012 0.5 0.0007
Q9WTS6 2715 Teneurin-3 OS=Mus musculu no N/A 0.486 0.013 0.472 0.0009
>sp|O61307|TENM_DROME Teneurin-m OS=Drosophila melanogaster GN=Ten-m PE=1 SV=2 Back     alignment and function desciption
 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 27/39 (69%)

Query: 36  TQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR 74
           ++ LCD DCG HG C GDAC C+  W GEYCN + CD R
Sbjct: 676 SKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVR 714
Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Acts as a homophilic and heterophilic synaptic cell adhesion molecule that drives synapse assembly. Promotes bi-directional trans-synaptic signaling with ten-a to organize neuromuscular synapses. Function in olfactory synaptic partner matching; promotes homophilic cell adhesion between pre-synaptic olfactory receptor neurons (ORN) axons and post-synaptic projection neurons (PN) dendrites partner in the developing antennal lobe to form stable connections. Also required for peripheral axon growth cone guidance and target recognition of motor neurons.
Drosophila melanogaster (taxid: 7227)
>sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=tenm3 PE=2 SV=1 Back     alignment and function description
>sp|Q9R1K2|TEN2_RAT Teneurin-2 OS=Rattus norvegicus GN=Tenm2 PE=1 SV=2 Back     alignment and function description
>sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=TENM2 PE=1 SV=3 Back     alignment and function description
>sp|Q9WTS5|TEN2_MOUSE Teneurin-2 OS=Mus musculus GN=Tenm2 PE=2 SV=1 Back     alignment and function description
>sp|Q9DER5|TEN2_CHICK Teneurin-2 OS=Gallus gallus GN=TENM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9WTS6|TEN3_MOUSE Teneurin-3 OS=Mus musculus GN=Tenm3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
328724902 2927 PREDICTED: teneurin-3-like isoform 1 [Ac 0.527 0.013 0.717 1e-10
328724904 2662 PREDICTED: teneurin-3-like isoform 2 [Ac 0.527 0.014 0.717 1e-10
242003399 2599 type II transmembrane protein, putative 0.5 0.014 0.717 3e-10
91081003 3108 PREDICTED: similar to odd Oz protein [Tr 0.486 0.011 0.722 2e-09
270006439 2957 tenascin major [Tribolium castaneum] 0.486 0.012 0.722 2e-09
307196795 3360 Teneurin-3 [Harpegnathos saltator] 0.527 0.011 0.666 2e-08
350404731 3457 PREDICTED: teneurin-3-like [Bombus impat 0.527 0.011 0.666 4e-08
332023466 3373 Teneurin-3 [Acromyrmex echinatior] 0.527 0.011 0.666 4e-08
340721624 3454 PREDICTED: teneurin-3-like [Bombus terre 0.527 0.011 0.666 4e-08
307187110 3344 Teneurin-3 [Camponotus floridanus] 0.527 0.011 0.666 4e-08
>gi|328724902|ref|XP_001945083.2| PREDICTED: teneurin-3-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/39 (71%), Positives = 34/39 (87%)

Query: 36  TQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR 74
           ++ LCD DCGTHGHCVGD C C++GWSG+YCNL+ CDNR
Sbjct: 881 SKELCDLDCGTHGHCVGDTCACHSGWSGQYCNLKLCDNR 919

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328724904|ref|XP_003248283.1| PREDICTED: teneurin-3-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242003399|ref|XP_002422722.1| type II transmembrane protein, putative [Pediculus humanus corporis] gi|212505544|gb|EEB09984.1| type II transmembrane protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91081003|ref|XP_975140.1| PREDICTED: similar to odd Oz protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270006439|gb|EFA02887.1| tenascin major [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307196795|gb|EFN78238.1| Teneurin-3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350404731|ref|XP_003487201.1| PREDICTED: teneurin-3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332023466|gb|EGI63709.1| Teneurin-3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340721624|ref|XP_003399217.1| PREDICTED: teneurin-3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307187110|gb|EFN72354.1| Teneurin-3 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
FB|FBgn0004449 2731 Ten-m "Tenascin major" [Drosop 0.527 0.014 0.589 9.6e-10
UNIPROTKB|E1C414831 ODZ2 "Uncharacterized protein" 0.918 0.081 0.338 2.8e-06
UNIPROTKB|F1NS18 2532 ODZ3 "Uncharacterized protein" 0.932 0.027 0.333 3e-06
UNIPROTKB|F1P1R1 2567 ODZ3 "Uncharacterized protein" 0.932 0.026 0.333 3e-06
UNIPROTKB|E1BMG7 2546 ODZ3 "Uncharacterized protein" 0.932 0.027 0.318 3.8e-06
MGI|MGI:1345183 2715 Tenm3 "teneurin transmembrane 0.932 0.025 0.318 4.1e-06
RGD|1306641 2529 Tenm3 "teneurin transmembrane 0.932 0.027 0.318 4.8e-06
UNIPROTKB|F1LV44 2545 Odz3 "Protein Odz3" [Rattus no 0.932 0.027 0.318 4.9e-06
UNIPROTKB|Q9P273 2699 TENM3 "Teneurin-3" [Homo sapie 0.932 0.025 0.318 5.2e-06
ZFIN|ZDB-GENE-990714-19 2778 tenm3 "teneurin transmembrane 0.918 0.024 0.342 8.7e-06
FB|FBgn0004449 Ten-m "Tenascin major" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 150 (57.9 bits), Expect = 9.6e-10, Sum P(2) = 9.6e-10
 Identities = 23/39 (58%), Positives = 27/39 (69%)

Query:    36 TQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR 74
             ++ LCD DCG HG C GDAC C+  W GEYCN + CD R
Sbjct:   676 SKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVR 714
GO:0005578 "proteinaceous extracellular matrix" evidence=ISS
GO:0007155 "cell adhesion" evidence=ISS;IMP
GO:0005887 "integral to plasma membrane" evidence=IDA
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0042051 "compound eye photoreceptor development" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0048058 "compound eye corneal lens development" evidence=IMP
GO:0022416 "chaeta development" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0031005 "filamin binding" evidence=IDA
GO:0008045 "motor neuron axon guidance" evidence=IMP
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0045211 "postsynaptic membrane" evidence=IDA
GO:0016200 "synaptic target attraction" evidence=IMP
GO:0042802 "identical protein binding" evidence=IDA
UNIPROTKB|E1C414 ODZ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NS18 ODZ3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1R1 ODZ3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMG7 ODZ3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1345183 Tenm3 "teneurin transmembrane protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306641 Tenm3 "teneurin transmembrane protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LV44 Odz3 "Protein Odz3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P273 TENM3 "Teneurin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990714-19 tenm3 "teneurin transmembrane protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
KOG1225|consensus 525 99.31
KOG1225|consensus 525 99.07
KOG1226|consensus 783 98.72
KOG1226|consensus 783 98.68
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 98.61
smart0005163 DSL delta serrate ligand. 97.93
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 97.35
KOG4289|consensus 2531 96.81
KOG4289|consensus 2531 96.56
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 96.5
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 96.07
KOG3607|consensus716 95.97
KOG4260|consensus 350 95.95
PF0000832 EGF: EGF-like domain This is a sub-family of the P 95.75
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 95.16
KOG1219|consensus 4289 95.07
smart0017939 EGF_CA Calcium-binding EGF-like domain. 94.37
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 94.18
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 94.18
cd0005336 EGF Epidermal growth factor domain, found in epide 93.81
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 92.19
smart0018135 EGF Epidermal growth factor-like domain. 91.93
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 91.29
PHA02887126 EGF-like protein; Provisional 91.1
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 88.13
KOG1219|consensus 4289 87.46
PHA03099139 epidermal growth factor-like protein (EGF-like pro 85.1
>KOG1225|consensus Back     alignment and domain information 
Probab=99.31  E-value=3.8e-12  Score=94.86  Aligned_cols=67  Identities=27%  Similarity=0.705  Sum_probs=55.8

Q ss_pred             CCCCCCccccccccccCCCCCCeeeC-------CCCCCCCCCCCCCcccCCCCceEeCCeeEeCCCccCCCCCCCCCC
Q psy10560          2 FHSGVCETQRAAHTYAVSHSGHSEGI-------QDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCD   72 (74)
Q Consensus         2 ~~~~~C~~~~~~c~~~~~Csg~G~c~-------~~~~G~~C~~~~C~~~C~~~G~C~~g~C~C~~g~~G~~C~~~~C~   72 (74)
                      |-|.+|+..  .|  +..||+||.+.       ++|+|.+|++..|+.+|.+||.|+.|+|+|++||+|..|+.++|+
T Consensus       273 f~G~dC~e~--~C--p~~cs~~g~~~~g~CiC~~g~~G~dCs~~~cpadC~g~G~Ci~G~C~C~~Gy~G~~C~~~~C~  346 (525)
T KOG1225|consen  273 FTGDDCDEL--VC--PVDCSGGGVCVDGECICNPGYSGKDCSIRRCPADCSGHGKCIDGECLCDEGYTGELCIQRACS  346 (525)
T ss_pred             CcCCCCCcc--cC--CcccCCCceecCCEeecCCCccccccccccCCccCCCCCcccCCceEeCCCCcCCcccccccC
Confidence            677888873  34  66699987764       578999999888999999999999999999999999999987554

>KOG1225|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>KOG3607|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 4e-07
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-04
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 3e-04
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
 Score = 44.3 bits (103), Expect = 4e-07
 Identities = 13/40 (32%), Positives = 17/40 (42%)

Query: 32  HTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQC 71
                   C   C  HG CV  +CVC+  W G YC+  + 
Sbjct: 529 DNVYIGDGCLDMCSGHGRCVQGSCVCDEQWGGLYCDEPET 568
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Length = 503 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.95
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.95
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 98.89
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.85
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.8
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 98.8
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.74
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 98.65
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.61
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.5
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.37
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 98.28
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.19
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.08
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.03
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.94
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.86
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.85
2ddu_A 387 Reelin; beta-jelly-roll, signaling protein; 2.05A 97.71
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.68
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.42
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.35
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 97.3
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.07
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 96.99
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.84
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.72
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.71
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 96.55
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.52
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.51
2bou_A143 EGF-like module containing mucin-like hormone rece 96.2
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.2
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.19
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 96.09
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.99
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.88
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 95.87
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 95.85
1aut_L114 Activated protein C; serine proteinase, plasma cal 95.74
1aut_L114 Activated protein C; serine proteinase, plasma cal 95.68
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 95.68
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 95.45
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.37
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.26
2k2s_B61 Micronemal protein 6; microneme protein complex, c 94.23
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.93
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 93.86
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 93.78
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 93.66
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.65
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 93.51
2bou_A 143 EGF-like module containing mucin-like hormone rece 93.5
2i9a_A145 Urokinase-type plasminogen activator; growth facto 93.16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 93.09
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 93.05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 92.21
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 91.78
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 91.52
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 91.24
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 91.19
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 91.02
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 90.74
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 89.94
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 89.66
2vh0_B134 Activated factor XA light chain; serine protease, 88.76
1jlz_A26 Tityustoxin alpha-KTX; scorpion venom, K+-channel 88.74
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 88.6
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 88.33
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 88.3
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 88.0
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 87.72
2vh0_B134 Activated factor XA light chain; serine protease, 86.67
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 86.47
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 85.72
1nfu_B 195 Coagulation factor XA, light chain; hydrolase; HET 85.51
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 84.51
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 83.46
1r1g_A31 Neurotoxin BMK37, BMBKTTX1; siras from S atoms, sc 82.23
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 82.2
1cmr_A31 Charybdotoxin, alpha chimera; antagonist of nicoti 81.82
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 81.4
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
Probab=98.95  E-value=9.5e-10  Score=83.11  Aligned_cols=71  Identities=24%  Similarity=0.453  Sum_probs=57.9

Q ss_pred             CCCCCCcccccccccc--CCCCCCeeeC-------CCCCCCCCC----CCCCc----ccCCCCceEeCCeeEe-CCCccC
Q psy10560          2 FHSGVCETQRAAHTYA--VSHSGHSEGI-------QDSEHTSLT----QPLCD----KDCGTHGHCVGDACVC-NAGWSG   63 (74)
Q Consensus         2 ~~~~~C~~~~~~c~~~--~~Csg~G~c~-------~~~~G~~C~----~~~C~----~~C~~~G~C~~g~C~C-~~g~~G   63 (74)
                      |.|..||.+...|.-.  ..|++||+|.       .+|+|.+|+    ...|.    ..|+++|+|+.++|+| .+||+|
T Consensus       516 y~G~~Ce~~~~~C~~~~~~~C~~~G~C~~g~C~C~~Gy~G~~CeC~~~~~~C~~~~g~~C~~~G~C~~g~C~C~~~Gy~G  595 (690)
T 3fcs_B          516 ITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYG  595 (690)
T ss_dssp             CBSTTSCBCSSCCCBSSSSBGGGSEEEETTEEEECTTEESSSSCEECCCTTTBCTTSSBTSSSCEEETTEEECCSTTCBS
T ss_pred             eeCCCcCcccCcCcCCCCCCCCCCCEecCCeeECcCCCcCCCCccCCCCCcccCCCCCCCCCCCEEeCCEEECCCCCccC
Confidence            7788999877767211  3699999874       689999998    56787    4699999999999999 999999


Q ss_pred             CCCCC-CCCC
Q psy10560         64 EYCNL-QQCD   72 (74)
Q Consensus        64 ~~C~~-~~C~   72 (74)
                      +.|+. +.|+
T Consensus       596 ~~Ce~C~~C~  605 (690)
T 3fcs_B          596 DTCEKCPTCP  605 (690)
T ss_dssp             TTSCBCTTSC
T ss_pred             CCcCcCCCCC
Confidence            99998 6564
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1r1g_A Neurotoxin BMK37, BMBKTTX1; siras from S atoms, scorpion toxin, reductive dimethylation; HET: MLY; 1.72A {Synthetic} SCOP: g.3.7.2 PDB: 1q2k_A 3e8y_X Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1cmr_A Charybdotoxin, alpha chimera; antagonist of nicotinic acetylcholine receptor, curaremimetic protein; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 98.77
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 98.62
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 98.48
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.49
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.44
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.43
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.43
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.33
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.29
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.27
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.24
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.11
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.71
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.55
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.48
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.18
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.76
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 95.62
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 95.47
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.0
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 93.9
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 93.49
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.91
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 91.13
d1jlza_26 alpha-KTX, K+-channel blocker {Scorpion (Tityus ca 89.99
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 85.1
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 84.8
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 80.8
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Integrin beta EGF-like domains
domain: Integrin beta EGF-like domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.77  E-value=2.2e-09  Score=54.18  Aligned_cols=30  Identities=33%  Similarity=0.894  Sum_probs=26.4

Q ss_pred             cCCCCceEeCCeeEe-CCCccCCCCCC-CCCC
Q psy10560         43 DCGTHGHCVGDACVC-NAGWSGEYCNL-QQCD   72 (74)
Q Consensus        43 ~C~~~G~C~~g~C~C-~~g~~G~~C~~-~~C~   72 (74)
                      .|++||+|+.|+|+| +++|+|+.|+. |.||
T Consensus        12 iCng~G~C~cG~C~C~~~gy~G~~Ce~CptCP   43 (43)
T d1jv2b5          12 LCSGRGKCECGSCVCIQPGSYGDTCEKCPTCP   43 (43)
T ss_dssp             GGGGTEEEETTEEEECCSSCBSTTSCBCTTSC
T ss_pred             EECCCCEEECCEeEeCCCCccCCccccCCCCC
Confidence            599999999999999 58999999997 5554
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlza_ g.3.7.2 (A:) alpha-KTX, K+-channel blocker {Scorpion (Tityus cambridgei) [TaxId: 184226]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure