Diaphorina citri psyllid: psy10574


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MANEIRELNLNRTNDIKAVHRGLKFSCKFTFNECLQRWFTLLYDPNLSRLAVQGMQNLHPEVVHNIQAKALFSNDEEELLGSIKSPGYTLRFIGFSLLILEKKELKKVEEEMKNWAVIVDHVTGSNTPELDKQTYAVLRGRAVRYLMKFRDVTLGRSTADHSVDIDLSLEGPAWKVSRRQACIRMRNNGDFFIANEGKRPIYVDGRPIIASNKYKLNHNSIIERFDRGNWNC
ccccHHHHHHHccccHHHHHcccEEcccccHHHHHHHcHHccccccccHHHHHcccccccHHHHHHHHHcccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccccccEEEEEEccEEEEEEEcEEEEcccccccccEEEccccccccccccccEEEEEcccccEEEEEcccccEEEccEECccccEEEcccccEEEEEccccccc
*ANEIRELNLNRTNDIKAVHRGLKFSCKFTFNECLQRWFTLLYDPNLSRLAVQGMQNLHPEVVHNIQAKALFSNDEEELLGSIKSPGYTLRFIGFSLLILEKKELKKVEEEMKNWAVIVDHVTGSNTPELDKQTYAVLRGRAVRYLMKFRDVTLGRSTADHSVDIDLSLEGPAWKVSRRQACIRMRNNGDFFIANEGKRPIYVDGRPIIASNKYKLNHNSIIERFDRGN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANEIRELNLNRTNDIKAVHRGLKFSCKFTFNECLQRWFTLLYDPNLSRLAVQGMQNLHPEVVHNIQAKALFSNDEEELLGSIKSPGYTLRFIGFSLLILEKKELKKVEEEMKNWAVIVDHVTGSNTPELDKQTYAVLRGRAVRYLMKFRDVTLGRSTADHSVDIDLSLEGPAWKVSRRQACIRMRNNGDFFIANEGKRPIYVDGRPIIASNKYKLNHNSIIERFDRGNWNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microspherule protein 1 Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. May also be an inhibitor of TERT telomerase activity.confidentQ99L90
Microspherule protein 1 Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. May also be an inhibitor of TERT telomerase activity.confidentQ96EZ8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046972 [MF]histone acetyltransferase activity (H4-K16 specific)probableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0043982 [BP]histone H4-K8 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043981 [BP]histone H4-K5 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043995 [MF]histone acetyltransferase activity (H4-K5 specific)probableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0031011 [CC]Ino80 complexprobableGO:0033202, GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000123 [CC]histone acetyltransferase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043996 [MF]histone acetyltransferase activity (H4-K8 specific)probableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0071339 [CC]MLL1 complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422, GO:0044665
GO:0043984 [BP]histone H4-K16 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G3G, chain A
Confidence level:confident
Coverage over the Query: 134-227
View the alignment between query and template
View the model in PyMOL
Template: 3OSG, chain A
Confidence level:probable
Coverage over the Query: 3-47,68-83
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 115-130
View the alignment between query and template
View the model in PyMOL