Diaphorina citri psyllid: psy10618


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
METVTKEVGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY
cccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccEEECcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEccccEEEECcccccEEEcccccccEEccccccccccccccccccccccccccccccccccccccccccccEEcEEccccccEEEEccccccccccccc
*********EPFLIDMTKMLQLMGQCQTLRAIPKSKFAV*************QTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLS******************SAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METVTKEVGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tensin-1 May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.confidentQ9HBL0
Tensin-1 May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.confidentQ9GLM4
Tensin May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.confidentQ04205

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HQC, chain A
Confidence level:very confident
Coverage over the Query: 187-314
View the alignment between query and template
View the model in PyMOL
Template: 1POC, chain A
Confidence level:very confident
Coverage over the Query: 63-115
View the alignment between query and template
View the model in PyMOL
Template: 2KNO, chain A
Confidence level:confident
Coverage over the Query: 121-174
View the alignment between query and template
View the model in PyMOL