Psyllid ID: psy10618


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
METVTKEVGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY
cccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEccccEEEEEcccccEEEcccccccEEccccccccccccccccccccccccccccccccccccccccccccEEcEEccccccEEEEccccccccccccc
cccccHccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccEcEccccccccccccccccccccccccccEEccccccEccccccccccccccccccccccccccccccccHHHHHHEEEccccccEEEcccccccccccHHHHEEHccccccccccEEEcccccccccccccccccccHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEcccccEEEHEccccccEEEEEcccHcccccEccccccccccccccEEEEEEEcccccccHHHEHHHHccccccEEEEEcccccEEcccccc
metvtkevgepfLIDMTKMLQLMGQcqtlraipkskfavrsvkdkrpnpqitqttsayplfngiipgtkwcgtgdiadtyfdlgseikldkccrthdlcpskirahtnrynitndsmytnNELVRHFlieptprgvrlkgcsnepvfSSLSALVYQhsvlplalpcrlslpdsepslppdavspsiTSAQLLLAQGAACNVLYLVSVdtesltgpqAVTRAINSlfgtkplphaAVVHFKvssqgitltdnkrqlffrrhypvasisycgldpedsrcltrpwciskshcscdknfKSCLKSTKSAAADVMGEFYFNifrvpciidtpsgkkfkfpgvy
metvtkevgepflIDMTKMLQLMGQCQTLRaipkskfavrsvkdkrpnpqitqttsayplfnGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDlcpskirahtnrynitndsmYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIidtpsgkkfkfpgvy
METVTKEVGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRlslpdsepslppdAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY
*********EPFLIDMTKMLQLMGQCQTLRAIPKSKFAV*************QTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLS******************SAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTP***********
**********P*LIDMTKMLQLMG*************************************NGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRL***************************GAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCL**********CSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTP***********
METVTKEVGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY
*******VGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNR****NDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSE*************SAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METVTKEVGEPFLIDMTKMLQLMGQCQTLRAIPKSKFAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSMYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEFYFNIFRVPCIIDTPSGKKFKFPGVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q9GLM41715 Tensin-1 OS=Bos taurus GN yes N/A 0.463 0.091 0.605 7e-52
Q042051744 Tensin OS=Gallus gallus G yes N/A 0.463 0.090 0.598 1e-51
Q9HBL01735 Tensin-1 OS=Homo sapiens yes N/A 0.469 0.091 0.591 2e-51
Q5SSZ51440 Tensin-3 OS=Mus musculus no N/A 0.471 0.111 0.604 4e-50
Q68CZ21445 Tensin-3 OS=Homo sapiens no N/A 0.469 0.110 0.614 2e-49
Q63HR21409 Tensin-like C1 domain-con no N/A 0.463 0.111 0.597 3e-47
Q8CGB61400 Tensin-like C1 domain-con no N/A 0.466 0.112 0.581 7e-47
Q32PJ7716 Tensin-4 OS=Bos taurus GN no N/A 0.539 0.255 0.445 2e-38
Q8IZW8715 Tensin-4 OS=Homo sapiens no N/A 0.463 0.219 0.506 4e-38
Q8BZ33696 Tensin-4 OS=Mus musculus no N/A 0.536 0.261 0.432 2e-35
>sp|Q9GLM4|TENS1_BOVIN Tensin-1 OS=Bos taurus GN=TNS1 PE=2 SV=1 Back     alignment and function desciption
 Score =  204 bits (519), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 95/157 (60%), Positives = 122/157 (77%)

Query: 121  NELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPD 180
            +ELVRHFLIE  PRGV+LKGC NEP F SLSALVYQHS++PLALPC+L +P+ +P+    
Sbjct: 1501 HELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESK 1560

Query: 181  AVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFK 240
              S    S   LL QGAACNVL++ SVD ESLTGPQA+++AI+      P P A +VHFK
Sbjct: 1561 DSSGPANSTSDLLKQGAACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFK 1620

Query: 241  VSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSR 277
            VS+QGITLTDN+R+LFFRRHYP+ ++++C LDP++ +
Sbjct: 1621 VSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERK 1657




May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.
Bos taurus (taxid: 9913)
>sp|Q04205|TENS_CHICK Tensin OS=Gallus gallus GN=TNS PE=1 SV=2 Back     alignment and function description
>sp|Q9HBL0|TENS1_HUMAN Tensin-1 OS=Homo sapiens GN=TNS1 PE=1 SV=2 Back     alignment and function description
>sp|Q5SSZ5|TENS3_MOUSE Tensin-3 OS=Mus musculus GN=Tns3 PE=1 SV=1 Back     alignment and function description
>sp|Q68CZ2|TENS3_HUMAN Tensin-3 OS=Homo sapiens GN=TNS3 PE=1 SV=2 Back     alignment and function description
>sp|Q63HR2|TENC1_HUMAN Tensin-like C1 domain-containing phosphatase OS=Homo sapiens GN=TENC1 PE=1 SV=2 Back     alignment and function description
>sp|Q8CGB6|TENC1_MOUSE Tensin-like C1 domain-containing phosphatase OS=Mus musculus GN=Tenc1 PE=1 SV=1 Back     alignment and function description
>sp|Q32PJ7|TENS4_BOVIN Tensin-4 OS=Bos taurus GN=TNS4 PE=2 SV=2 Back     alignment and function description
>sp|Q8IZW8|TENS4_HUMAN Tensin-4 OS=Homo sapiens GN=TNS4 PE=1 SV=3 Back     alignment and function description
>sp|Q8BZ33|TENS4_MOUSE Tensin-4 OS=Mus musculus GN=Tns4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
242007688 1186 tens, putative [Pediculus humanus corpor 0.451 0.129 0.738 3e-60
307172058 1046 Tensin [Camponotus floridanus] 0.466 0.151 0.709 3e-58
307191833 1084 Tensin [Harpegnathos saltator] 0.486 0.152 0.670 6e-58
322796699 1530 hypothetical protein SINV_02908 [Solenop 0.528 0.116 0.627 6e-58
332019537 1055 Tensin [Acromyrmex echinatior] 0.454 0.145 0.713 2e-57
340723449 1406 PREDICTED: hypothetical protein LOC10064 0.448 0.108 0.709 6e-57
340723447 1645 PREDICTED: hypothetical protein LOC10064 0.448 0.092 0.709 8e-57
350427112 1660 PREDICTED: hypothetical protein LOC10074 0.448 0.091 0.709 9e-57
383855316 1634 PREDICTED: uncharacterized protein LOC10 0.471 0.097 0.672 2e-56
321467998276 hypothetical protein DAPPUDRAFT_305032 [ 0.504 0.619 0.616 7e-54
>gi|242007688|ref|XP_002424660.1| tens, putative [Pediculus humanus corporis] gi|212508153|gb|EEB11922.1| tens, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/157 (73%), Positives = 134/157 (85%), Gaps = 4/157 (2%)

Query: 121  NELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPD 180
            +ELVRHFLIEPT RGVRLKGC+NEPVFSSLSALVYQHS+  +ALP RL LP+ E  +   
Sbjct: 969  DELVRHFLIEPTSRGVRLKGCANEPVFSSLSALVYQHSITNMALPTRLLLPECERKIE-- 1026

Query: 181  AVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFK 240
              S + ++AQ LLAQGAACNVLYL++VDTESLTGPQA+ +AIN LF TKPLP A +VHFK
Sbjct: 1027 --SLNTSTAQQLLAQGAACNVLYLITVDTESLTGPQAIRKAINQLFLTKPLPVAVIVHFK 1084

Query: 241  VSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSR 277
            VS QGITLTDNKRQ+FFRRHYPVA+IS+CGLDP+D R
Sbjct: 1085 VSGQGITLTDNKRQIFFRRHYPVAAISHCGLDPDDHR 1121




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307172058|gb|EFN63652.1| Tensin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307191833|gb|EFN75259.1| Tensin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322796699|gb|EFZ19132.1| hypothetical protein SINV_02908 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332019537|gb|EGI60016.1| Tensin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340723449|ref|XP_003400102.1| PREDICTED: hypothetical protein LOC100644032 isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340723447|ref|XP_003400101.1| PREDICTED: hypothetical protein LOC100644032 isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350427112|ref|XP_003494656.1| PREDICTED: hypothetical protein LOC100746638 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383855316|ref|XP_003703160.1| PREDICTED: uncharacterized protein LOC100875678 [Megachile rotundata] Back     alignment and taxonomy information
>gi|321467998|gb|EFX78985.1| hypothetical protein DAPPUDRAFT_305032 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
ZFIN|ZDB-GENE-030131-69331769 tns1 "tensin 1" [Danio rerio ( 0.463 0.088 0.573 1.8e-45
UNIPROTKB|F1ST781451 TNS3 "Uncharacterized protein" 0.483 0.113 0.602 2.1e-45
UNIPROTKB|F1P1J01744 TNS1 "Uncharacterized protein" 0.463 0.090 0.573 6.1e-45
UNIPROTKB|Q042051744 TNS "Tensin" [Gallus gallus (t 0.463 0.090 0.573 6.1e-45
UNIPROTKB|Q59G71873 TNS1 "Tensin-1" [Homo sapiens 0.463 0.179 0.579 1.4e-44
RGD|15641741444 Tns3 "tensin 3" [Rattus norveg 0.466 0.109 0.612 1.5e-44
UNIPROTKB|Q9GLM41715 TNS1 "Tensin-1" [Bos taurus (t 0.463 0.091 0.585 1.5e-44
UNIPROTKB|E1BNT51767 TNS1 "Tensin-1" [Bos taurus (t 0.463 0.088 0.585 1.6e-44
UNIPROTKB|Q68CZ21445 TNS3 "Tensin-3" [Homo sapiens 0.463 0.108 0.603 2.9e-44
ZFIN|ZDB-GENE-090312-1631606 tenc1a "tensin like C1 domain 0.530 0.112 0.510 4.7e-44
ZFIN|ZDB-GENE-030131-6933 tns1 "tensin 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 492 (178.3 bits), Expect = 1.8e-45, P = 1.8e-45
 Identities = 90/157 (57%), Positives = 114/157 (72%)

Query:   121 NELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRXXXXXXXXXXXXX 180
             NELVRHFLIE +P+GVRLKGC NEP F  LSALVYQHS+ PLALPC+             
Sbjct:  1557 NELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEESP 1616

Query:   181 AVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFK 240
              ++     A  +L QGAACNVLY+ SVD ESLTGPQA+ +AI+      P P A +VHFK
Sbjct:  1617 EIATPTNPAADMLKQGAACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFK 1676

Query:   241 VSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSR 277
             VS+QGITLTDN+R+LFFRRHYP+ ++++C +DP++ +
Sbjct:  1677 VSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERK 1713




GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1ST78 TNS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1J0 TNS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q04205 TNS "Tensin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q59G71 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1564174 Tns3 "tensin 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GLM4 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNT5 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q68CZ2 TNS3 "Tensin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-163 tenc1a "tensin like C1 domain containing phosphatase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q04205TENS_CHICKNo assigned EC number0.59870.46310.0900yesN/A
Q9HBL0TENS1_HUMANNo assigned EC number0.59110.46900.0916yesN/A
Q9GLM4TENS1_BOVINNo assigned EC number0.60500.46310.0915yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691
3rd Layer3.1.1.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
cd01213136 cd01213, PTB_tensin, Tensin Phosphotyrosine-bindin 3e-48
cd09927116 cd09927, SH2_Tensin_like, Src homology 2 domain fo 1e-28
pfam08416131 pfam08416, PTB, Phosphotyrosine-binding domain 4e-25
cd0470497 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: 3e-24
pfam0582699 pfam05826, Phospholip_A2_2, Phospholipase A2 3e-23
smart00462134 smart00462, PTB, Phosphotyrosine-binding domain, p 7e-16
cd0470497 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: 4e-09
cd00934119 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik 8e-09
pfam0582699 pfam05826, Phospholip_A2_2, Phospholipase A2 1e-07
cd0061883 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a 6e-07
>gnl|CDD|241249 cd01213, PTB_tensin, Tensin Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
 Score =  158 bits (402), Expect = 3e-48
 Identities = 60/96 (62%), Positives = 71/96 (73%), Gaps = 5/96 (5%)

Query: 196 GAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQL 255
           GAACNVLYL SVDTESLTGPQAV +A++      PLP   VVHFKVS QGITLTDN+R+L
Sbjct: 1   GAACNVLYLGSVDTESLTGPQAVRKAVSETLERDPLPTPTVVHFKVSEQGITLTDNQRKL 60

Query: 256 FFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCS 291
           FFRRHYPV ++S+CG+DPE+     R W   +   S
Sbjct: 61  FFRRHYPVNTVSFCGMDPEN-----RKWQKRELRGS 91


Tensin is a a focal adhesion protein, which contains a C-terminal SH2 domain followed by a PTB domain. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 136

>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins Back     alignment and domain information
>gnl|CDD|219831 pfam08416, PTB, Phosphotyrosine-binding domain Back     alignment and domain information
>gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
>gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 Back     alignment and domain information
>gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
>gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 Back     alignment and domain information
>gnl|CDD|153092 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
KOG1930|consensus483 100.0
cd01213138 tensin Tensin Phosphotyrosine-binding (PTB) domain 100.0
PF0582699 Phospholip_A2_2: Phospholipase A2; InterPro: IPR00 100.0
cd0470497 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-fam 100.0
PF08416131 PTB: Phosphotyrosine-binding domain; InterPro: IPR 99.92
cd01212148 JIP JNK-interacting protein (JIP) Phosphotyrosine- 99.44
cd04705100 PLA2_group_III_like PLA2_group_III_like: A sub-fam 99.24
cd00934123 PTB Phosphotyrosine-binding (PTB) domain. Phosphot 99.18
smart00462134 PTB Phosphotyrosine-binding domain, phosphotyrosin 99.12
cd01267132 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, 99.12
cd0061883 PLA2_like PLA2_like: Phospholipase A2, a super-fam 98.87
cd01273142 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. 98.68
cd01268138 Numb Numb Phosphotyrosine-binding (PTB) domain. Nu 98.47
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 98.45
cd01216123 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph 98.4
cd04705100 PLA2_group_III_like PLA2_group_III_like: A sub-fam 98.32
cd01274127 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma 98.29
cd01214133 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain 98.28
PF14719182 PID_2: Phosphotyrosine interaction domain (PTB/PID 98.28
smart00085117 PA2c Phospholipase A2. 98.15
cd01215139 Dab Disabled (Dab) Phosphotyrosine-binding domain. 97.61
cd01271124 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PT 97.4
cd01270140 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos 97.22
KOG3775|consensus482 96.87
cd04706117 PLA2_plant PLA2_plant: Plant-specific sub-family o 96.77
cd01209160 SHC SHC phosphotyrosine-binding (PTB) domain. SHC 96.23
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 94.76
cd04707117 otoconin_90 otoconin_90: Phospholipase A2-like dom 93.58
cd00125115 PLA2c PLA2c: Phospholipase A2, a family of secreto 93.19
PF0839864 Parvo_coat_N: Parvovirus coat protein VP1; InterPr 93.04
KOG3537|consensus 543 92.6
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 92.47
cd01217158 CG12581 CG12581 Phosphotyrosine-binding (PTB) doma 91.15
cd01211125 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) doma 90.68
>KOG1930|consensus Back     alignment and domain information
Probab=100.00  E-value=3.6e-81  Score=614.79  Aligned_cols=233  Identities=49%  Similarity=0.813  Sum_probs=208.5

Q ss_pred             hhhhhhccCCCCCCcccccccccccccccCCccccCCCCCCCCccCCCCccccchhhccccCCccccccCcccccccCCC
Q psy10618         37 FAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDS  116 (339)
Q Consensus        37 ~~~~~~~d~~~~~~~~~~~~~~~~~~~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~kygLtN~s  116 (339)
                      -++.+++|++|+.++.+++..++..                     +|.+.++-       .=|..+.++.         
T Consensus       223 QAIalLrdkePGtFvvRDS~SfrGa---------------------yGLAlKVs-------tPPPs~~~~~---------  265 (483)
T KOG1930|consen  223 QAIALLRDKEPGTFVVRDSHSFRGA---------------------YGLALKVS-------TPPPSVQPGD---------  265 (483)
T ss_pred             HHHHHhhcCCCCeEEEecCCcCCCc---------------------cceEEEec-------cCCCcccCCC---------
Confidence            3566788999999988887776533                     45777776       4555555543         


Q ss_pred             CcchhhhhhhhccccCCCCceeccCCCCCCCCchhhheeccccccccccccccCCCCCCCCCCCCCCCCCchHHHHHhhc
Q psy10618        117 MYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQG  196 (339)
Q Consensus       117 gyT~~~lvrHfLIe~~~~gv~lkGc~~Ep~F~Slsalv~qhsi~~laLPC~L~iP~~d~~~~~~~~~~~~~~~~~ll~~g  196 (339)
                      +...+|||||||||++++||+||||+|||||+||||||+||||++|||||+|+||++|+.+ +......++++++||+||
T Consensus       266 g~~~neLVRHFLIE~spkGVkLKGC~nEP~FGSLSALV~QHSIt~LALPckL~iP~rDp~e-e~~~~~~~~a~a~LLkqG  344 (483)
T KOG1930|consen  266 GSDSNELVRHFLIEPSPKGVKLKGCDNEPVFGSLSALVYQHSITALALPCKLVIPDRDPLE-EAPVPEHTSATAALLKQG  344 (483)
T ss_pred             CCchhhhhhhheeccCCCceeccCCCCCCccchhHHHHhhccchhhhcceeEeccCCCccc-CCCCCCCchhHHHHHhhC
Confidence            2334899999999999999999999999999999999999999999999999999999965 445667889999999999


Q ss_pred             cccceeeeeeeccCCccchHHHHHHHHhhhCCCCCCCceEEEEEEecceeeeeccccccccccccCCCceeeecCCCCCC
Q psy10618        197 AACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDS  276 (339)
Q Consensus       197 aaCnvlyL~sv~~esltG~~Av~kAv~~~l~~~~~p~~tvVhFKVS~qGITLTDnqRKlFFRRHYp~n~v~fC~lDP~dR  276 (339)
                      ||||||||+|||||+|||++||+||++.++..+|.|.+|+||||||+|||||||||||||||||||+|+|+|||||||||
T Consensus       345 AACnVlyl~SVd~ESLTG~~av~kAt~~~~~~~p~p~~tvVHFKVSsQGITLTDNqRK~FFRRHypv~sv~Fc~mDPq~R  424 (483)
T KOG1930|consen  345 AACNVLYLGSVDVESLTGNEAVQKATSSQRAINPTPRATVVHFKVSSQGITLTDNQRKVFFRRHYPVNSVIFCGMDPQER  424 (483)
T ss_pred             ccceEEEEeeeeccccccHHHHHHHHHHHhhcCCCCCceEEEEEEeccceeeeccchhhheecccccceeEEecCChHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCcccccccccc-chhHHHHhcCCCChhhhhccee
Q psy10618        277 RCLTRPWCISKSHCSC-DKNFKSCLKSTKSAAADVMGEF  314 (339)
Q Consensus       277 rW~~~~~~~~~s~C~c-d~~F~~CLk~~~~~~sn~vG~~  314 (339)
                      ||++.|       |.- .++|+|++|+++.+.+|+||+|
T Consensus       425 ~w~~~g-------~~~~s~iFgFVAr~~gS~teN~CHlF  456 (483)
T KOG1930|consen  425 RWTNTG-------CGAQSKIFGFVARKPGSSTENVCHLF  456 (483)
T ss_pred             ccccCC-------CCCcceEEEEEeccCCCCcccceeee
Confidence            999963       333 6899999999999999999987



>cd01213 tensin Tensin Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF05826 Phospholip_A2_2: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
>PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein Back     alignment and domain information
>cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 Back     alignment and domain information
>cd00934 PTB Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 Back     alignment and domain information
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01214 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF14719 PID_2: Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>smart00085 PA2c Phospholipase A2 Back     alignment and domain information
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain Back     alignment and domain information
>cd01271 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia Back     alignment and domain information
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>PF08398 Parvo_coat_N: Parvovirus coat protein VP1; InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>KOG3537|consensus Back     alignment and domain information
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01217 CG12581 CG12581 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
3hqc_A157 Crystal Structure Of Phosphotyrosine-binding Domain 1e-29
2loz_A147 The Novel Binding Mode Of Dlc1 And Tensin2 Ptb Doma 3e-29
2dkq_A160 Solution Structure Of The Ptb Domain Of Kiaa1075 Pr 7e-29
1wvh_A134 Crystal Structure Of Tensin1 Ptb Domain Length = 13 5e-26
2gjy_A144 Nmr Solution Structure Of Tensin1 Ptb Domain Length 5e-26
2kno_A131 Nmr Solution Structure Of Sh2 Domain Of The Human T 2e-12
2l6k_A123 Solution Structure Of A Nonphosphorylated Peptide R 2e-12
1poc_A134 Crystal Structure Of Bee-venom Phospholipase A2 In 7e-07
>pdb|3HQC|A Chain A, Crystal Structure Of Phosphotyrosine-binding Domain From The Human Tensin-like C1 Domain-containing Phosphatase (tenc1) Length = 157 Back     alignment and structure

Iteration: 1

Score = 127 bits (318), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 61/93 (65%), Positives = 74/93 (79%) Query: 185 SITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQ 244 S+++A LL QGAAC+VLYL SV+TESLTGPQAV RA ++ P P AVVHFKVS+Q Sbjct: 2 SLSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQ 61 Query: 245 GITLTDNKRQLFFRRHYPVASISYCGLDPEDSR 277 GITLTDN+R+LFFRRHYPV SI++ DP+D R Sbjct: 62 GITLTDNQRKLFFRRHYPVNSITFSSTDPQDRR 94
>pdb|2LOZ|A Chain A, The Novel Binding Mode Of Dlc1 And Tensin2 Ptb Domain Length = 147 Back     alignment and structure
>pdb|2DKQ|A Chain A, Solution Structure Of The Ptb Domain Of Kiaa1075 Protein From Human Length = 160 Back     alignment and structure
>pdb|1WVH|A Chain A, Crystal Structure Of Tensin1 Ptb Domain Length = 134 Back     alignment and structure
>pdb|2GJY|A Chain A, Nmr Solution Structure Of Tensin1 Ptb Domain Length = 144 Back     alignment and structure
>pdb|2KNO|A Chain A, Nmr Solution Structure Of Sh2 Domain Of The Human Tensin Like C1 Domain Containing Phosphatase (Tenc1) Length = 131 Back     alignment and structure
>pdb|2L6K|A Chain A, Solution Structure Of A Nonphosphorylated Peptide Recognizing Domain Length = 123 Back     alignment and structure
>pdb|1POC|A Chain A, Crystal Structure Of Bee-venom Phospholipase A2 In A Complex With A Transition-state Analogue Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
3hqc_A157 Tensin-like C1 domain-containing phosphatase; TENC 6e-41
1wvh_A134 Tensin, tensin1; beta sandwich, cell adhesion; 1.5 5e-38
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 4e-21
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 3e-20
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 3e-08
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 2e-14
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 4e-14
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 2e-12
2ela_A175 Adapter protein containing PH domain, PTB domain a 1e-10
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 8e-10
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 1e-07
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 2e-06
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 3e-06
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 7e-06
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 1e-05
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 2e-04
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 6e-04
>3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} PDB: 2dkq_A Length = 157 Back     alignment and structure
 Score =  139 bits (352), Expect = 6e-41
 Identities = 63/106 (59%), Positives = 77/106 (72%), Gaps = 1/106 (0%)

Query: 185 SITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQ 244
           S+++A  LL QGAAC+VLYL SV+TESLTGPQAV RA ++     P P  AVVHFKVS+Q
Sbjct: 2   SLSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQ 61

Query: 245 GITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHC 290
           GITLTDN+R+LFFRRHYPV SI++   DP+D R  T P   +    
Sbjct: 62  GITLTDNQRKLFFRRHYPVNSITFSSTDPQD-RRWTNPDGTTSKIF 106


>1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Length = 134 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 Back     alignment and structure
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Length = 136 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Length = 176 Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
3hqc_A157 Tensin-like C1 domain-containing phosphatase; TENC 100.0
1wvh_A134 Tensin, tensin1; beta sandwich, cell adhesion; 1.5 100.0
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 100.0
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 99.47
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 99.46
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 99.41
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 99.26
2ela_A175 Adapter protein containing PH domain, PTB domain a 99.16
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 99.13
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 98.44
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 98.38
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 98.36
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 98.34
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 98.31
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 98.3
1n3h_A207 SHC transforming protein; free protein, beta sandw 98.27
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 97.73
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 97.54
3d8d_A148 Amyloid beta A4 precursor protein-binding family 1 96.92
3suz_A 388 Amyloid beta A4 precursor protein-binding family 2 95.99
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 95.89
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 95.63
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 95.59
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 95.52
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 95.38
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 95.25
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 95.16
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 95.12
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 95.11
2wg7_A130 PLA2, putative phospholipase A2; hydrolase, secret 95.06
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 94.91
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 94.62
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 94.57
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 94.43
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 94.4
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 94.22
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 94.18
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 94.0
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 93.81
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 93.65
2dly_A121 FYN-related kinase; BRK family kinase, structural 93.43
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 93.29
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 93.2
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 92.93
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 92.74
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 92.29
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 92.23
2vif_A141 Suppressor of cytokine signalling 6; growth regula 91.78
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 91.74
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 91.34
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 91.04
2aug_A126 Growth factor receptor-bound protein 14; phosphory 90.81
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 90.66
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 90.3
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 90.19
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 89.52
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 89.51
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 89.26
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 89.15
1gp7_A151 Phospholipase A2; snake venom, KING cobra, cardiot 88.0
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 87.67
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 87.26
1g4i_A123 Phospholipase A2; lipid degradation, hydrolase; 0. 87.19
1p7o_A124 Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 86.78
3jql_A119 Phospholipase A2 isoform 3; phospholipase A2, hexa 86.72
3u8i_A124 Phospholipase A2, membrane associated; secreted ph 86.02
4e4c_A119 Phospholipase A2; hydrolase; HET: MES; 1.80A {Note 85.91
1bun_A120 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 85.81
3r0l_D122 Phospholipase A2 CB; crotoxin, presynaptic neuroto 85.52
1bk9_A124 Phospholipase A2; hydrolase, platelet aggregation 85.49
3vbz_A118 Phospholipase A2 homolog, taipoxin beta chain; pho 85.48
2g58_A121 Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d 85.33
1jlt_A122 Phospholipase A2 inhibitor; heterodimer complex, h 85.28
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 85.09
1g0z_A118 Phospholipase A2; toxin; 2.18A {Bungarus caeruleus 85.0
2aoz_A121 Myotoxin II, phospholipase A2 homolog; X-RAY diffr 84.92
4h0q_A121 Phospholipase A2, acid 5; alpha-helix, glycerophos 84.92
1zlb_A122 Hypotensive phospholipase A2; Asp49-PLA2, toxin, s 84.8
3dih_A122 Phospholipase A2 homolog, ammodytin L; phospholipa 84.7
2qhd_A122 Phospholipase A2; beta sheet, three helices, prote 84.11
1m8t_A119 Phospholipase A2; twinned crystal, alpha, beta, hy 83.89
1mc2_A122 Acutohaemonlysin, phospholipase A2; YS49-phospholi 83.84
4hg9_A122 Basic phospholipase A2 B; alpha-helix, glycerophos 83.79
1le6_A123 Group X secretory phospholipase A2; human phosphat 83.7
4h0s_A137 Svpla2 homolog, basic phospholipase A2 homolog CTS 83.53
1oz6_A120 Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { 83.49
2h4c_B122 Phospholipase A2-II; non-inhibitor acidic PLA2, ba 83.29
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 83.22
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 83.16
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 83.1
1gmz_A122 Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot 83.06
1jlt_B122 Phospholipase A2, vipoxin; heterodimer complex, hy 83.03
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 82.93
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 82.92
1vip_A121 Phospholipase A2; hydrolase, anticoagulant; 2.20A 82.8
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 81.95
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 80.88
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 80.52
>3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} SCOP: b.55.1.2 PDB: 2loz_A 2dkq_A Back     alignment and structure
Probab=100.00  E-value=2.2e-47  Score=336.19  Aligned_cols=122  Identities=54%  Similarity=0.791  Sum_probs=113.4

Q ss_pred             CchHHHHHhhccccceeeeeeeccCCccchHHHHHHHHhhhCCCCCCCceEEEEEEecceeeeeccccccccccccCCCc
Q psy10618        186 ITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVAS  265 (339)
Q Consensus       186 ~~~~~~ll~~gaaCnvlyL~sv~~esltG~~Av~kAv~~~l~~~~~p~~tvVhFKVS~qGITLTDnqRKlFFRRHYp~n~  265 (339)
                      ++++++||+|||||||+||||||||+|+|++||+|||+.+|+.++.|.|++||||||.||||||||+||+|||||||+++
T Consensus         3 ~~~~~~lL~qgaacnv~yLgSvevesltG~~av~kAv~~~l~~~~~~~~t~V~fkVS~qGItLtD~~rK~FfrrHypl~~   82 (157)
T 3hqc_A            3 LSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNS   82 (157)
T ss_dssp             -CCHHHHHHHCEEEEEEEEEEEECTTCCHHHHHHHHHHHHHHCC---CCEEEEEEEETTEEEEEEEETTEEEEEEEEGGG
T ss_pred             cchHHHHHhcCCeeeEEEeceEecCCCCChHHHHHHHHHHHhcCCCCCCeEEEEEEeCCCceEEecccceeehhcCcccc
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecCCCCCCccccCCccccccccccchhHHHHhcCCCChhhhhccee
Q psy10618        266 ISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEF  314 (339)
Q Consensus       266 v~fC~lDP~dRrW~~~~~~~~~s~C~cd~~F~~CLk~~~~~~sn~vG~~  314 (339)
                      |+||++||+||||.+..       |..+++|+|++|+++++.+|+|+.|
T Consensus        83 IsFC~~DP~~r~w~~~~-------~~~~riFGFVARk~~s~~~n~CHlF  124 (157)
T 3hqc_A           83 ITFSSTDPQDRRWTNPD-------GTTSKIFGFVAKKPGSPWENVCHLF  124 (157)
T ss_dssp             EEEEEECTTCCEEECTT-------SCEEEEEEEEEEETTEEEEEEEEEE
T ss_pred             eEeecCChhhccccccC-------CCcccEEEEEEccCCCCCCeeEEEe
Confidence            99999999999999863       4667999999999998889999987



>1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Back     alignment and structure
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Back     alignment and structure
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} SCOP: b.55.1.0 PDB: 3dxd_A 3dxc_A Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Back     alignment and structure
>3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2wg7_A PLA2, putative phospholipase A2; hydrolase, secretory PLA2; 2.00A {Oryza sativa} PDB: 2wg9_A* 2wg8_B 2wg8_A Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... Back     alignment and structure
>1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A Back     alignment and structure
>3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} SCOP: a.133.1.2 PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... Back     alignment and structure
>3u8i_A Phospholipase A2, membrane associated; secreted phospholipase A2, hydrolase; HET: OLD; 1.10A {Homo sapiens} PDB: 3u8d_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* 3u8b_A 1kvo_A* 3u8h_A* 1n28_B 1n29_A Back     alignment and structure
>4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A Back     alignment and structure
>1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 Back     alignment and structure
>3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} SCOP: a.133.1.2 PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A Back     alignment and structure
>1bk9_A Phospholipase A2; hydrolase, platelet aggregation inhibitor, PBPB; HET: PBP; 2.00A {Gloydius halys} SCOP: a.133.1.2 PDB: 1psj_A 1ijl_A 1pp2_R Back     alignment and structure
>3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A Back     alignment and structure
>2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... Back     alignment and structure
>1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* Back     alignment and structure
>2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} Back     alignment and structure
>4h0q_A Phospholipase A2, acid 5; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.60A {Viridovipera stejnegeri} PDB: 1m8r_A 1m8s_A Back     alignment and structure
>1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A Back     alignment and structure
>3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 3ux7_A Back     alignment and structure
>2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* Back     alignment and structure
>1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... Back     alignment and structure
>4hg9_A Basic phospholipase A2 B; alpha-helix, glycerophospholipid, venom gland, hydrolase; HET: CIT G3P; 1.60A {Gloydius halys} PDB: 1jia_A 1b4w_A 1c1j_A* Back     alignment and structure
>1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A Back     alignment and structure
>4h0s_A Svpla2 homolog, basic phospholipase A2 homolog CTS-R6; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.55A {Viridovipera stejnegeri} Back     alignment and structure
>1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 Back     alignment and structure
>2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 Back     alignment and structure
>1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d2dkqa1147 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [T 9e-30
d1wvha1133 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gal 3e-23
d1poca_134 a.133.1.1 (A:) Phospholipase A2 {European honeybee 4e-23
d1poca_134 a.133.1.1 (A:) Phospholipase A2 {European honeybee 1e-07
d1ntva_152 b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu 8e-14
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 2e-13
d1p3ra_148 b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu 6e-13
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 3e-12
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 1e-11
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 1e-07
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 5e-07
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 8e-07
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 2e-06
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 4e-06
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 2e-05
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 2e-05
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 3e-05
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 3e-05
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 4e-05
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 4e-05
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 5e-05
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 5e-05
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 6e-05
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 9e-05
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 9e-05
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 1e-04
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 2e-04
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 2e-04
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 4e-04
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 7e-04
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 9e-04
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 0.003
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 0.003
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: Tensin
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  109 bits (273), Expect = 9e-30
 Identities = 62/106 (58%), Positives = 76/106 (71%), Gaps = 1/106 (0%)

Query: 186 ITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQG 245
           +++A  LL QGAAC+VLYL SV+TESLTGPQAV RA ++     P P  AVVHFKVS+QG
Sbjct: 1   MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQG 60

Query: 246 ITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCS 291
           ITLTDN+R+LFFRRHYPV SI++   DP+D R  T P   +     
Sbjct: 61  ITLTDNQRKLFFRRHYPVNSITFSSTDPQD-RRWTNPDGTTSKIFG 105


>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 Back     information, alignment and structure
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1poca_134 Phospholipase A2 {European honeybee (Apis mellifer 100.0
d2dkqa1147 Tensin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wvha1133 Tensin {Chicken (Gallus gallus) [TaxId: 9031]} 99.91
d1wgua_136 Amyloid beta A4 precursor protein-binding family B 99.39
d1ntva_152 Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T 99.18
d1p3ra_148 Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T 99.06
d1ddma_135 Numb {Fruit fly (Drosophila melanogaster) [TaxId: 99.02
d1wj1a_156 Numb {Mouse (Mus musculus) [TaxId: 10090]} 99.0
d2cy5a1129 EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) 98.19
d1oy2a_191 Shc adaptor protein {Human (Homo sapiens) [TaxId: 98.11
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 96.17
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 96.17
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 96.07
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 95.99
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 95.7
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 95.63
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 95.54
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 95.39
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 95.36
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 95.36
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 95.04
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 94.8
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 94.37
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 94.08
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 93.99
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 93.77
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 93.73
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 93.66
d1n28a_124 Phospholipase A2 {Human (Homo sapiens), synovial f 93.36
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 92.88
d1ae7a_119 Snake phospholipase A2 {Mainland tiger snake (Note 92.58
d1buna_120 Snake phospholipase A2 {Many-banded krait (Bungaru 92.49
d1le6a_123 Phospholipase A2 {Human (Homo sapiens), SPLA2 [Tax 92.39
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 92.33
d1m8ta_119 Snake phospholipase A2 {King cobra (Ophiophagus ha 92.26
d1g0za_118 Snake phospholipase A2 {Indian krait (Bungarus cae 92.24
d1sz8a_119 Snake phospholipase A2 {Andaman cobra (Naja sagitt 91.96
d1g4ia_123 Phospholipase A2 {Cow (Bos taurus), pancreas [TaxI 91.66
d1zlba1122 Snake phospholipase A2 {Jararacussu (Bothrops jara 91.64
d1oz6a_120 Snake phospholipase A2 {Saw-scaled viper (Echis ca 91.6
d1p7oa_124 Snake phospholipase A2 {Small-eye snake (Micropech 91.0
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 90.88
d1jltb_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 90.13
d2g58a1121 Snake phospholipase A2 {Snake (Daboia russellii pu 90.1
d1m8ra_124 Snake phospholipase A2 {Snake (Agkistrodon halys) 89.94
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 89.53
d1jlta_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 89.32
d1gmza_122 Snake phospholipase A2 {Snake (Bothrops pirajai), 89.28
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 89.27
d1vipa_121 Snake phospholipase A2 {Russell's viper (Vipera ru 89.2
d1jiaa_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 89.0
d1ppaa_121 Snake phospholipase A2 {Eastern cottonmouth snake 88.82
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 88.59
d1mc2a_122 Snake phospholipase A2 {Hundred-pace snake (Agkist 88.5
d1bjja_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 88.34
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 88.02
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 84.73
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Back     information, alignment and structure
class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]
Probab=100.00  E-value=3.7e-35  Score=250.71  Aligned_cols=55  Identities=40%  Similarity=0.803  Sum_probs=52.7

Q ss_pred             cccCCccccCCCCCCCCccCCCCccccchhhccccCCccccccCcccccccCCCC
Q psy10618         63 GIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSM  117 (339)
Q Consensus        63 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~kygLtN~sg  117 (339)
                      .|+|||||||+||+|.+|+|||.+.++|+|||+||+||++|+++++||||+|.+.
T Consensus         1 ~i~PGTkWCG~Gn~A~~~~dlG~~~~~D~CCR~HD~Cp~~I~~~~~k~gl~N~~~   55 (134)
T d1poca_           1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTAS   55 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSS
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchhhHhHccCcccccccccccceecCCc
Confidence            4899999999999999999999999999999999999999999999999999643



>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} Back     information, alignment and structure
>d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} Back     information, alignment and structure
>d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} Back     information, alignment and structure
>d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} Back     information, alignment and structure
>d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} Back     information, alignment and structure
>d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} Back     information, alignment and structure
>d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} Back     information, alignment and structure
>d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} Back     information, alignment and structure
>d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} Back     information, alignment and structure
>d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} Back     information, alignment and structure
>d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} Back     information, alignment and structure
>d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure