Psyllid ID: psy10618
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 339 | ||||||
| 242007688 | 1186 | tens, putative [Pediculus humanus corpor | 0.451 | 0.129 | 0.738 | 3e-60 | |
| 307172058 | 1046 | Tensin [Camponotus floridanus] | 0.466 | 0.151 | 0.709 | 3e-58 | |
| 307191833 | 1084 | Tensin [Harpegnathos saltator] | 0.486 | 0.152 | 0.670 | 6e-58 | |
| 322796699 | 1530 | hypothetical protein SINV_02908 [Solenop | 0.528 | 0.116 | 0.627 | 6e-58 | |
| 332019537 | 1055 | Tensin [Acromyrmex echinatior] | 0.454 | 0.145 | 0.713 | 2e-57 | |
| 340723449 | 1406 | PREDICTED: hypothetical protein LOC10064 | 0.448 | 0.108 | 0.709 | 6e-57 | |
| 340723447 | 1645 | PREDICTED: hypothetical protein LOC10064 | 0.448 | 0.092 | 0.709 | 8e-57 | |
| 350427112 | 1660 | PREDICTED: hypothetical protein LOC10074 | 0.448 | 0.091 | 0.709 | 9e-57 | |
| 383855316 | 1634 | PREDICTED: uncharacterized protein LOC10 | 0.471 | 0.097 | 0.672 | 2e-56 | |
| 321467998 | 276 | hypothetical protein DAPPUDRAFT_305032 [ | 0.504 | 0.619 | 0.616 | 7e-54 |
| >gi|242007688|ref|XP_002424660.1| tens, putative [Pediculus humanus corporis] gi|212508153|gb|EEB11922.1| tens, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 238 bits (607), Expect = 3e-60, Method: Compositional matrix adjust.
Identities = 116/157 (73%), Positives = 134/157 (85%), Gaps = 4/157 (2%)
Query: 121 NELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPD 180
+ELVRHFLIEPT RGVRLKGC+NEPVFSSLSALVYQHS+ +ALP RL LP+ E +
Sbjct: 969 DELVRHFLIEPTSRGVRLKGCANEPVFSSLSALVYQHSITNMALPTRLLLPECERKIE-- 1026
Query: 181 AVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFK 240
S + ++AQ LLAQGAACNVLYL++VDTESLTGPQA+ +AIN LF TKPLP A +VHFK
Sbjct: 1027 --SLNTSTAQQLLAQGAACNVLYLITVDTESLTGPQAIRKAINQLFLTKPLPVAVIVHFK 1084
Query: 241 VSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSR 277
VS QGITLTDNKRQ+FFRRHYPVA+IS+CGLDP+D R
Sbjct: 1085 VSGQGITLTDNKRQIFFRRHYPVAAISHCGLDPDDHR 1121
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307172058|gb|EFN63652.1| Tensin [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307191833|gb|EFN75259.1| Tensin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322796699|gb|EFZ19132.1| hypothetical protein SINV_02908 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332019537|gb|EGI60016.1| Tensin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340723449|ref|XP_003400102.1| PREDICTED: hypothetical protein LOC100644032 isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340723447|ref|XP_003400101.1| PREDICTED: hypothetical protein LOC100644032 isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350427112|ref|XP_003494656.1| PREDICTED: hypothetical protein LOC100746638 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383855316|ref|XP_003703160.1| PREDICTED: uncharacterized protein LOC100875678 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|321467998|gb|EFX78985.1| hypothetical protein DAPPUDRAFT_305032 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 339 | ||||||
| ZFIN|ZDB-GENE-030131-6933 | 1769 | tns1 "tensin 1" [Danio rerio ( | 0.463 | 0.088 | 0.573 | 1.8e-45 | |
| UNIPROTKB|F1ST78 | 1451 | TNS3 "Uncharacterized protein" | 0.483 | 0.113 | 0.602 | 2.1e-45 | |
| UNIPROTKB|F1P1J0 | 1744 | TNS1 "Uncharacterized protein" | 0.463 | 0.090 | 0.573 | 6.1e-45 | |
| UNIPROTKB|Q04205 | 1744 | TNS "Tensin" [Gallus gallus (t | 0.463 | 0.090 | 0.573 | 6.1e-45 | |
| UNIPROTKB|Q59G71 | 873 | TNS1 "Tensin-1" [Homo sapiens | 0.463 | 0.179 | 0.579 | 1.4e-44 | |
| RGD|1564174 | 1444 | Tns3 "tensin 3" [Rattus norveg | 0.466 | 0.109 | 0.612 | 1.5e-44 | |
| UNIPROTKB|Q9GLM4 | 1715 | TNS1 "Tensin-1" [Bos taurus (t | 0.463 | 0.091 | 0.585 | 1.5e-44 | |
| UNIPROTKB|E1BNT5 | 1767 | TNS1 "Tensin-1" [Bos taurus (t | 0.463 | 0.088 | 0.585 | 1.6e-44 | |
| UNIPROTKB|Q68CZ2 | 1445 | TNS3 "Tensin-3" [Homo sapiens | 0.463 | 0.108 | 0.603 | 2.9e-44 | |
| ZFIN|ZDB-GENE-090312-163 | 1606 | tenc1a "tensin like C1 domain | 0.530 | 0.112 | 0.510 | 4.7e-44 |
| ZFIN|ZDB-GENE-030131-6933 tns1 "tensin 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 492 (178.3 bits), Expect = 1.8e-45, P = 1.8e-45
Identities = 90/157 (57%), Positives = 114/157 (72%)
Query: 121 NELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRXXXXXXXXXXXXX 180
NELVRHFLIE +P+GVRLKGC NEP F LSALVYQHS+ PLALPC+
Sbjct: 1557 NELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEESP 1616
Query: 181 AVSPSITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFK 240
++ A +L QGAACNVLY+ SVD ESLTGPQA+ +AI+ P P A +VHFK
Sbjct: 1617 EIATPTNPAADMLKQGAACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFK 1676
Query: 241 VSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDSR 277
VS+QGITLTDN+R+LFFRRHYP+ ++++C +DP++ +
Sbjct: 1677 VSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERK 1713
|
|
| UNIPROTKB|F1ST78 TNS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P1J0 TNS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q04205 TNS "Tensin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59G71 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1564174 Tns3 "tensin 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GLM4 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNT5 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q68CZ2 TNS3 "Tensin-3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090312-163 tenc1a "tensin like C1 domain containing phosphatase a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 339 | |||
| cd01213 | 136 | cd01213, PTB_tensin, Tensin Phosphotyrosine-bindin | 3e-48 | |
| cd09927 | 116 | cd09927, SH2_Tensin_like, Src homology 2 domain fo | 1e-28 | |
| pfam08416 | 131 | pfam08416, PTB, Phosphotyrosine-binding domain | 4e-25 | |
| cd04704 | 97 | cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: | 3e-24 | |
| pfam05826 | 99 | pfam05826, Phospholip_A2_2, Phospholipase A2 | 3e-23 | |
| smart00462 | 134 | smart00462, PTB, Phosphotyrosine-binding domain, p | 7e-16 | |
| cd04704 | 97 | cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: | 4e-09 | |
| cd00934 | 119 | cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik | 8e-09 | |
| pfam05826 | 99 | pfam05826, Phospholip_A2_2, Phospholipase A2 | 1e-07 | |
| cd00618 | 83 | cd00618, PLA2_like, PLA2_like: Phospholipase A2, a | 6e-07 |
| >gnl|CDD|241249 cd01213, PTB_tensin, Tensin Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
Score = 158 bits (402), Expect = 3e-48
Identities = 60/96 (62%), Positives = 71/96 (73%), Gaps = 5/96 (5%)
Query: 196 GAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQL 255
GAACNVLYL SVDTESLTGPQAV +A++ PLP VVHFKVS QGITLTDN+R+L
Sbjct: 1 GAACNVLYLGSVDTESLTGPQAVRKAVSETLERDPLPTPTVVHFKVSEQGITLTDNQRKL 60
Query: 256 FFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCS 291
FFRRHYPV ++S+CG+DPE+ R W + S
Sbjct: 61 FFRRHYPVNTVSFCGMDPEN-----RKWQKRELRGS 91
|
Tensin is a a focal adhesion protein, which contains a C-terminal SH2 domain followed by a PTB domain. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 136 |
| >gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219831 pfam08416, PTB, Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 | Back alignment and domain information |
|---|
| >gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 | Back alignment and domain information |
|---|
| >gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 | Back alignment and domain information |
|---|
| >gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold | Back alignment and domain information |
|---|
| >gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 | Back alignment and domain information |
|---|
| >gnl|CDD|153092 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| KOG1930|consensus | 483 | 100.0 | ||
| cd01213 | 138 | tensin Tensin Phosphotyrosine-binding (PTB) domain | 100.0 | |
| PF05826 | 99 | Phospholip_A2_2: Phospholipase A2; InterPro: IPR00 | 100.0 | |
| cd04704 | 97 | PLA2_bee_venom_like PLA2_bee_venom_like: A sub-fam | 100.0 | |
| PF08416 | 131 | PTB: Phosphotyrosine-binding domain; InterPro: IPR | 99.92 | |
| cd01212 | 148 | JIP JNK-interacting protein (JIP) Phosphotyrosine- | 99.44 | |
| cd04705 | 100 | PLA2_group_III_like PLA2_group_III_like: A sub-fam | 99.24 | |
| cd00934 | 123 | PTB Phosphotyrosine-binding (PTB) domain. Phosphot | 99.18 | |
| smart00462 | 134 | PTB Phosphotyrosine-binding domain, phosphotyrosin | 99.12 | |
| cd01267 | 132 | CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, | 99.12 | |
| cd00618 | 83 | PLA2_like PLA2_like: Phospholipase A2, a super-fam | 98.87 | |
| cd01273 | 142 | CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. | 98.68 | |
| cd01268 | 138 | Numb Numb Phosphotyrosine-binding (PTB) domain. Nu | 98.47 | |
| PF00640 | 140 | PID: Phosphotyrosine interaction domain (PTB/PID) | 98.45 | |
| cd01216 | 123 | Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph | 98.4 | |
| cd04705 | 100 | PLA2_group_III_like PLA2_group_III_like: A sub-fam | 98.32 | |
| cd01274 | 127 | AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma | 98.29 | |
| cd01214 | 133 | CG8312 CG8312 Phosphotyrosine-binding (PTB) domain | 98.28 | |
| PF14719 | 182 | PID_2: Phosphotyrosine interaction domain (PTB/PID | 98.28 | |
| smart00085 | 117 | PA2c Phospholipase A2. | 98.15 | |
| cd01215 | 139 | Dab Disabled (Dab) Phosphotyrosine-binding domain. | 97.61 | |
| cd01271 | 124 | Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PT | 97.4 | |
| cd01270 | 140 | DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos | 97.22 | |
| KOG3775|consensus | 482 | 96.87 | ||
| cd04706 | 117 | PLA2_plant PLA2_plant: Plant-specific sub-family o | 96.77 | |
| cd01209 | 160 | SHC SHC phosphotyrosine-binding (PTB) domain. SHC | 96.23 | |
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 94.76 | |
| cd04707 | 117 | otoconin_90 otoconin_90: Phospholipase A2-like dom | 93.58 | |
| cd00125 | 115 | PLA2c PLA2c: Phospholipase A2, a family of secreto | 93.19 | |
| PF08398 | 64 | Parvo_coat_N: Parvovirus coat protein VP1; InterPr | 93.04 | |
| KOG3537|consensus | 543 | 92.6 | ||
| cd01208 | 156 | X11 X11 Phosphotyrosine-binding (PTB) domain. X11 | 92.47 | |
| cd01217 | 158 | CG12581 CG12581 Phosphotyrosine-binding (PTB) doma | 91.15 | |
| cd01211 | 125 | GAPCenA GAPCenA Phosphotyrosine-binding (PTB) doma | 90.68 |
| >KOG1930|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-81 Score=614.79 Aligned_cols=233 Identities=49% Similarity=0.813 Sum_probs=208.5
Q ss_pred hhhhhhccCCCCCCcccccccccccccccCCccccCCCCCCCCccCCCCccccchhhccccCCccccccCcccccccCCC
Q psy10618 37 FAVRSVKDKRPNPQITQTTSAYPLFNGIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDS 116 (339)
Q Consensus 37 ~~~~~~~d~~~~~~~~~~~~~~~~~~~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~kygLtN~s 116 (339)
-++.+++|++|+.++.+++..++.. +|.+.++- .=|..+.++.
T Consensus 223 QAIalLrdkePGtFvvRDS~SfrGa---------------------yGLAlKVs-------tPPPs~~~~~--------- 265 (483)
T KOG1930|consen 223 QAIALLRDKEPGTFVVRDSHSFRGA---------------------YGLALKVS-------TPPPSVQPGD--------- 265 (483)
T ss_pred HHHHHhhcCCCCeEEEecCCcCCCc---------------------cceEEEec-------cCCCcccCCC---------
Confidence 3566788999999988887776533 45777776 4555555543
Q ss_pred CcchhhhhhhhccccCCCCceeccCCCCCCCCchhhheeccccccccccccccCCCCCCCCCCCCCCCCCchHHHHHhhc
Q psy10618 117 MYTNNELVRHFLIEPTPRGVRLKGCSNEPVFSSLSALVYQHSVLPLALPCRLSLPDSEPSLPPDAVSPSITSAQLLLAQG 196 (339)
Q Consensus 117 gyT~~~lvrHfLIe~~~~gv~lkGc~~Ep~F~Slsalv~qhsi~~laLPC~L~iP~~d~~~~~~~~~~~~~~~~~ll~~g 196 (339)
+...+|||||||||++++||+||||+|||||+||||||+||||++|||||+|+||++|+.+ +......++++++||+||
T Consensus 266 g~~~neLVRHFLIE~spkGVkLKGC~nEP~FGSLSALV~QHSIt~LALPckL~iP~rDp~e-e~~~~~~~~a~a~LLkqG 344 (483)
T KOG1930|consen 266 GSDSNELVRHFLIEPSPKGVKLKGCDNEPVFGSLSALVYQHSITALALPCKLVIPDRDPLE-EAPVPEHTSATAALLKQG 344 (483)
T ss_pred CCchhhhhhhheeccCCCceeccCCCCCCccchhHHHHhhccchhhhcceeEeccCCCccc-CCCCCCCchhHHHHHhhC
Confidence 2334899999999999999999999999999999999999999999999999999999965 445667889999999999
Q ss_pred cccceeeeeeeccCCccchHHHHHHHHhhhCCCCCCCceEEEEEEecceeeeeccccccccccccCCCceeeecCCCCCC
Q psy10618 197 AACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVASISYCGLDPEDS 276 (339)
Q Consensus 197 aaCnvlyL~sv~~esltG~~Av~kAv~~~l~~~~~p~~tvVhFKVS~qGITLTDnqRKlFFRRHYp~n~v~fC~lDP~dR 276 (339)
||||||||+|||||+|||++||+||++.++..+|.|.+|+||||||+|||||||||||||||||||+|+|+|||||||||
T Consensus 345 AACnVlyl~SVd~ESLTG~~av~kAt~~~~~~~p~p~~tvVHFKVSsQGITLTDNqRK~FFRRHypv~sv~Fc~mDPq~R 424 (483)
T KOG1930|consen 345 AACNVLYLGSVDVESLTGNEAVQKATSSQRAINPTPRATVVHFKVSSQGITLTDNQRKVFFRRHYPVNSVIFCGMDPQER 424 (483)
T ss_pred ccceEEEEeeeeccccccHHHHHHHHHHHhhcCCCCCceEEEEEEeccceeeeccchhhheecccccceeEEecCChHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCCcccccccccc-chhHHHHhcCCCChhhhhccee
Q psy10618 277 RCLTRPWCISKSHCSC-DKNFKSCLKSTKSAAADVMGEF 314 (339)
Q Consensus 277 rW~~~~~~~~~s~C~c-d~~F~~CLk~~~~~~sn~vG~~ 314 (339)
||++.| |.- .++|+|++|+++.+.+|+||+|
T Consensus 425 ~w~~~g-------~~~~s~iFgFVAr~~gS~teN~CHlF 456 (483)
T KOG1930|consen 425 RWTNTG-------CGAQSKIFGFVARKPGSSTENVCHLF 456 (483)
T ss_pred ccccCC-------CCCcceEEEEEeccCCCCcccceeee
Confidence 999963 333 6899999999999999999987
|
|
| >cd01213 tensin Tensin Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PF05826 Phospholip_A2_2: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 | Back alignment and domain information |
|---|
| >cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 | Back alignment and domain information |
|---|
| >PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein | Back alignment and domain information |
|---|
| >cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 | Back alignment and domain information |
|---|
| >cd00934 PTB Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
| >cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains | Back alignment and domain information |
|---|
| >cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 | Back alignment and domain information |
|---|
| >cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01214 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PF14719 PID_2: Phosphotyrosine interaction domain (PTB/PID) | Back alignment and domain information |
|---|
| >smart00085 PA2c Phospholipase A2 | Back alignment and domain information |
|---|
| >cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >cd01271 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
| >cd01209 SHC SHC phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
| >cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia | Back alignment and domain information |
|---|
| >cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
| >PF08398 Parvo_coat_N: Parvovirus coat protein VP1; InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides | Back alignment and domain information |
|---|
| >KOG3537|consensus | Back alignment and domain information |
|---|
| >cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01217 CG12581 CG12581 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 339 | ||||
| 3hqc_A | 157 | Crystal Structure Of Phosphotyrosine-binding Domain | 1e-29 | ||
| 2loz_A | 147 | The Novel Binding Mode Of Dlc1 And Tensin2 Ptb Doma | 3e-29 | ||
| 2dkq_A | 160 | Solution Structure Of The Ptb Domain Of Kiaa1075 Pr | 7e-29 | ||
| 1wvh_A | 134 | Crystal Structure Of Tensin1 Ptb Domain Length = 13 | 5e-26 | ||
| 2gjy_A | 144 | Nmr Solution Structure Of Tensin1 Ptb Domain Length | 5e-26 | ||
| 2kno_A | 131 | Nmr Solution Structure Of Sh2 Domain Of The Human T | 2e-12 | ||
| 2l6k_A | 123 | Solution Structure Of A Nonphosphorylated Peptide R | 2e-12 | ||
| 1poc_A | 134 | Crystal Structure Of Bee-venom Phospholipase A2 In | 7e-07 |
| >pdb|3HQC|A Chain A, Crystal Structure Of Phosphotyrosine-binding Domain From The Human Tensin-like C1 Domain-containing Phosphatase (tenc1) Length = 157 | Back alignment and structure |
|
| >pdb|2LOZ|A Chain A, The Novel Binding Mode Of Dlc1 And Tensin2 Ptb Domain Length = 147 | Back alignment and structure |
| >pdb|2DKQ|A Chain A, Solution Structure Of The Ptb Domain Of Kiaa1075 Protein From Human Length = 160 | Back alignment and structure |
| >pdb|1WVH|A Chain A, Crystal Structure Of Tensin1 Ptb Domain Length = 134 | Back alignment and structure |
| >pdb|2GJY|A Chain A, Nmr Solution Structure Of Tensin1 Ptb Domain Length = 144 | Back alignment and structure |
| >pdb|2KNO|A Chain A, Nmr Solution Structure Of Sh2 Domain Of The Human Tensin Like C1 Domain Containing Phosphatase (Tenc1) Length = 131 | Back alignment and structure |
| >pdb|2L6K|A Chain A, Solution Structure Of A Nonphosphorylated Peptide Recognizing Domain Length = 123 | Back alignment and structure |
| >pdb|1POC|A Chain A, Crystal Structure Of Bee-venom Phospholipase A2 In A Complex With A Transition-state Analogue Length = 134 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 339 | |||
| 3hqc_A | 157 | Tensin-like C1 domain-containing phosphatase; TENC | 6e-41 | |
| 1wvh_A | 134 | Tensin, tensin1; beta sandwich, cell adhesion; 1.5 | 5e-38 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 4e-21 | |
| 1poc_A | 134 | Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis | 3e-20 | |
| 1poc_A | 134 | Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis | 3e-08 | |
| 2ej8_A | 160 | DCC-interacting protein 13 alpha; structural genom | 2e-14 | |
| 3f0w_A | 168 | NUMB-R, NUMB-like protein; PH domain-like, PID dom | 4e-14 | |
| 3so6_A | 137 | LDL receptor adaptor protein; PTB, endocytic adapt | 2e-12 | |
| 2ela_A | 175 | Adapter protein containing PH domain, PTB domain a | 1e-10 | |
| 1p3r_A | 160 | Disabled homolog 2; PTB, signaling protein; 2.10A | 8e-10 | |
| 1ntv_A | 152 | Disabled homolog 1; beta-sandwich, signaling prote | 1e-07 | |
| 4dbb_A | 162 | Amyloid beta A4 precursor protein-binding family 1 | 2e-06 | |
| 1wgu_A | 136 | APBB2, amyloid beta (A4) precursor protein-bindin, | 3e-06 | |
| 3dxe_A | 140 | Amyloid beta A4 protein-binding family B member 1; | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 2ysz_A | 185 | Amyloid beta A4 precursor protein-binding family B | 7e-06 | |
| 2yt0_A | 176 | Amyloid beta A4 protein and amyloid beta A4 precur | 1e-05 | |
| 2dyq_A | 144 | Amyloid beta A4 precursor protein-binding family 3 | 2e-04 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 6e-04 |
| >3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} PDB: 2dkq_A Length = 157 | Back alignment and structure |
|---|
Score = 139 bits (352), Expect = 6e-41
Identities = 63/106 (59%), Positives = 77/106 (72%), Gaps = 1/106 (0%)
Query: 185 SITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQ 244
S+++A LL QGAAC+VLYL SV+TESLTGPQAV RA ++ P P AVVHFKVS+Q
Sbjct: 2 SLSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQ 61
Query: 245 GITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHC 290
GITLTDN+R+LFFRRHYPV SI++ DP+D R T P +
Sbjct: 62 GITLTDNQRKLFFRRHYPVNSITFSSTDPQD-RRWTNPDGTTSKIF 106
|
| >1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Length = 134 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 | Back alignment and structure |
|---|
| >1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 | Back alignment and structure |
|---|
| >2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 | Back alignment and structure |
|---|
| >3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 | Back alignment and structure |
|---|
| >2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 | Back alignment and structure |
|---|
| >1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 | Back alignment and structure |
|---|
| >4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 | Back alignment and structure |
|---|
| >1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Length = 136 | Back alignment and structure |
|---|
| >3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 | Back alignment and structure |
|---|
| >2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Length = 176 | Back alignment and structure |
|---|
| >2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| 3hqc_A | 157 | Tensin-like C1 domain-containing phosphatase; TENC | 100.0 | |
| 1wvh_A | 134 | Tensin, tensin1; beta sandwich, cell adhesion; 1.5 | 100.0 | |
| 1poc_A | 134 | Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis | 100.0 | |
| 3f0w_A | 168 | NUMB-R, NUMB-like protein; PH domain-like, PID dom | 99.47 | |
| 3so6_A | 137 | LDL receptor adaptor protein; PTB, endocytic adapt | 99.46 | |
| 1p3r_A | 160 | Disabled homolog 2; PTB, signaling protein; 2.10A | 99.41 | |
| 2ej8_A | 160 | DCC-interacting protein 13 alpha; structural genom | 99.26 | |
| 2ela_A | 175 | Adapter protein containing PH domain, PTB domain a | 99.16 | |
| 1ntv_A | 152 | Disabled homolog 1; beta-sandwich, signaling prote | 99.13 | |
| 1wgu_A | 136 | APBB2, amyloid beta (A4) precursor protein-bindin, | 98.44 | |
| 2dyq_A | 144 | Amyloid beta A4 precursor protein-binding family 3 | 98.38 | |
| 2ysz_A | 185 | Amyloid beta A4 precursor protein-binding family B | 98.36 | |
| 2yt0_A | 176 | Amyloid beta A4 protein and amyloid beta A4 precur | 98.34 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 98.31 | |
| 3dxe_A | 140 | Amyloid beta A4 protein-binding family B member 1; | 98.3 | |
| 1n3h_A | 207 | SHC transforming protein; free protein, beta sandw | 98.27 | |
| 4dbb_A | 162 | Amyloid beta A4 precursor protein-binding family 1 | 97.73 | |
| 1aqc_A | 172 | X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 | 97.54 | |
| 3d8d_A | 148 | Amyloid beta A4 precursor protein-binding family 1 | 96.92 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 95.99 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 95.89 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 95.63 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 95.59 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 95.52 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 95.38 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 95.25 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 95.16 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 95.12 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 95.11 | |
| 2wg7_A | 130 | PLA2, putative phospholipase A2; hydrolase, secret | 95.06 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 94.91 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 94.62 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 94.57 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 94.43 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 94.4 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 94.22 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 94.18 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 94.0 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 93.81 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 93.65 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 93.43 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 93.29 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 93.2 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 92.93 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 92.74 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 92.29 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 92.23 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 91.78 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 91.74 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 91.34 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 91.04 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 90.81 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 90.66 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 90.3 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 90.19 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 89.52 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 89.51 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 89.26 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 89.15 | |
| 1gp7_A | 151 | Phospholipase A2; snake venom, KING cobra, cardiot | 88.0 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 87.67 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 87.26 | |
| 1g4i_A | 123 | Phospholipase A2; lipid degradation, hydrolase; 0. | 87.19 | |
| 1p7o_A | 124 | Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 | 86.78 | |
| 3jql_A | 119 | Phospholipase A2 isoform 3; phospholipase A2, hexa | 86.72 | |
| 3u8i_A | 124 | Phospholipase A2, membrane associated; secreted ph | 86.02 | |
| 4e4c_A | 119 | Phospholipase A2; hydrolase; HET: MES; 1.80A {Note | 85.91 | |
| 1bun_A | 120 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 85.81 | |
| 3r0l_D | 122 | Phospholipase A2 CB; crotoxin, presynaptic neuroto | 85.52 | |
| 1bk9_A | 124 | Phospholipase A2; hydrolase, platelet aggregation | 85.49 | |
| 3vbz_A | 118 | Phospholipase A2 homolog, taipoxin beta chain; pho | 85.48 | |
| 2g58_A | 121 | Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d | 85.33 | |
| 1jlt_A | 122 | Phospholipase A2 inhibitor; heterodimer complex, h | 85.28 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 85.09 | |
| 1g0z_A | 118 | Phospholipase A2; toxin; 2.18A {Bungarus caeruleus | 85.0 | |
| 2aoz_A | 121 | Myotoxin II, phospholipase A2 homolog; X-RAY diffr | 84.92 | |
| 4h0q_A | 121 | Phospholipase A2, acid 5; alpha-helix, glycerophos | 84.92 | |
| 1zlb_A | 122 | Hypotensive phospholipase A2; Asp49-PLA2, toxin, s | 84.8 | |
| 3dih_A | 122 | Phospholipase A2 homolog, ammodytin L; phospholipa | 84.7 | |
| 2qhd_A | 122 | Phospholipase A2; beta sheet, three helices, prote | 84.11 | |
| 1m8t_A | 119 | Phospholipase A2; twinned crystal, alpha, beta, hy | 83.89 | |
| 1mc2_A | 122 | Acutohaemonlysin, phospholipase A2; YS49-phospholi | 83.84 | |
| 4hg9_A | 122 | Basic phospholipase A2 B; alpha-helix, glycerophos | 83.79 | |
| 1le6_A | 123 | Group X secretory phospholipase A2; human phosphat | 83.7 | |
| 4h0s_A | 137 | Svpla2 homolog, basic phospholipase A2 homolog CTS | 83.53 | |
| 1oz6_A | 120 | Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { | 83.49 | |
| 2h4c_B | 122 | Phospholipase A2-II; non-inhibitor acidic PLA2, ba | 83.29 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 83.22 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 83.16 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 83.1 | |
| 1gmz_A | 122 | Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot | 83.06 | |
| 1jlt_B | 122 | Phospholipase A2, vipoxin; heterodimer complex, hy | 83.03 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 82.93 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 82.92 | |
| 1vip_A | 121 | Phospholipase A2; hydrolase, anticoagulant; 2.20A | 82.8 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 81.95 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 80.88 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 80.52 |
| >3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} SCOP: b.55.1.2 PDB: 2loz_A 2dkq_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-47 Score=336.19 Aligned_cols=122 Identities=54% Similarity=0.791 Sum_probs=113.4
Q ss_pred CchHHHHHhhccccceeeeeeeccCCccchHHHHHHHHhhhCCCCCCCceEEEEEEecceeeeeccccccccccccCCCc
Q psy10618 186 ITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQGITLTDNKRQLFFRRHYPVAS 265 (339)
Q Consensus 186 ~~~~~~ll~~gaaCnvlyL~sv~~esltG~~Av~kAv~~~l~~~~~p~~tvVhFKVS~qGITLTDnqRKlFFRRHYp~n~ 265 (339)
++++++||+|||||||+||||||||+|+|++||+|||+.+|+.++.|.|++||||||.||||||||+||+|||||||+++
T Consensus 3 ~~~~~~lL~qgaacnv~yLgSvevesltG~~av~kAv~~~l~~~~~~~~t~V~fkVS~qGItLtD~~rK~FfrrHypl~~ 82 (157)
T 3hqc_A 3 LSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNS 82 (157)
T ss_dssp -CCHHHHHHHCEEEEEEEEEEEECTTCCHHHHHHHHHHHHHHCC---CCEEEEEEEETTEEEEEEEETTEEEEEEEEGGG
T ss_pred cchHHHHHhcCCeeeEEEeceEecCCCCChHHHHHHHHHHHhcCCCCCCeEEEEEEeCCCceEEecccceeehhcCcccc
Confidence 67899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeecCCCCCCccccCCccccccccccchhHHHHhcCCCChhhhhccee
Q psy10618 266 ISYCGLDPEDSRCLTRPWCISKSHCSCDKNFKSCLKSTKSAAADVMGEF 314 (339)
Q Consensus 266 v~fC~lDP~dRrW~~~~~~~~~s~C~cd~~F~~CLk~~~~~~sn~vG~~ 314 (339)
|+||++||+||||.+.. |..+++|+|++|+++++.+|+|+.|
T Consensus 83 IsFC~~DP~~r~w~~~~-------~~~~riFGFVARk~~s~~~n~CHlF 124 (157)
T 3hqc_A 83 ITFSSTDPQDRRWTNPD-------GTTSKIFGFVAKKPGSPWENVCHLF 124 (157)
T ss_dssp EEEEEECTTCCEEECTT-------SCEEEEEEEEEEETTEEEEEEEEEE
T ss_pred eEeecCChhhccccccC-------CCcccEEEEEEccCCCCCCeeEEEe
Confidence 99999999999999863 4667999999999998889999987
|
| >1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A | Back alignment and structure |
|---|
| >1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 | Back alignment and structure |
|---|
| >3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A | Back alignment and structure |
|---|
| >3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A | Back alignment and structure |
|---|
| >2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* | Back alignment and structure |
|---|
| >1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B | Back alignment and structure |
|---|
| >2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} SCOP: b.55.1.0 PDB: 3dxd_A 3dxc_A | Back alignment and structure |
|---|
| >1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* | Back alignment and structure |
|---|
| >4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* | Back alignment and structure |
|---|
| >3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wg7_A PLA2, putative phospholipase A2; hydrolase, secretory PLA2; 2.00A {Oryza sativa} PDB: 2wg9_A* 2wg8_B 2wg8_A | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... | Back alignment and structure |
|---|
| >1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A | Back alignment and structure |
|---|
| >3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} SCOP: a.133.1.2 PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... | Back alignment and structure |
|---|
| >3u8i_A Phospholipase A2, membrane associated; secreted phospholipase A2, hydrolase; HET: OLD; 1.10A {Homo sapiens} PDB: 3u8d_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* 3u8b_A 1kvo_A* 3u8h_A* 1n28_B 1n29_A | Back alignment and structure |
|---|
| >4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A | Back alignment and structure |
|---|
| >1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} SCOP: a.133.1.2 PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A | Back alignment and structure |
|---|
| >1bk9_A Phospholipase A2; hydrolase, platelet aggregation inhibitor, PBPB; HET: PBP; 2.00A {Gloydius halys} SCOP: a.133.1.2 PDB: 1psj_A 1ijl_A 1pp2_R | Back alignment and structure |
|---|
| >3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A | Back alignment and structure |
|---|
| >2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... | Back alignment and structure |
|---|
| >1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* | Back alignment and structure |
|---|
| >2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} | Back alignment and structure |
|---|
| >4h0q_A Phospholipase A2, acid 5; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.60A {Viridovipera stejnegeri} PDB: 1m8r_A 1m8s_A | Back alignment and structure |
|---|
| >1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A | Back alignment and structure |
|---|
| >3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 3ux7_A | Back alignment and structure |
|---|
| >2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* | Back alignment and structure |
|---|
| >1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... | Back alignment and structure |
|---|
| >4hg9_A Basic phospholipase A2 B; alpha-helix, glycerophospholipid, venom gland, hydrolase; HET: CIT G3P; 1.60A {Gloydius halys} PDB: 1jia_A 1b4w_A 1c1j_A* | Back alignment and structure |
|---|
| >1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A | Back alignment and structure |
|---|
| >4h0s_A Svpla2 homolog, basic phospholipase A2 homolog CTS-R6; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.55A {Viridovipera stejnegeri} | Back alignment and structure |
|---|
| >1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 339 | ||||
| d2dkqa1 | 147 | b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [T | 9e-30 | |
| d1wvha1 | 133 | b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gal | 3e-23 | |
| d1poca_ | 134 | a.133.1.1 (A:) Phospholipase A2 {European honeybee | 4e-23 | |
| d1poca_ | 134 | a.133.1.1 (A:) Phospholipase A2 {European honeybee | 1e-07 | |
| d1ntva_ | 152 | b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu | 8e-14 | |
| d1ddma_ | 135 | b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga | 2e-13 | |
| d1p3ra_ | 148 | b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu | 6e-13 | |
| d1wgua_ | 136 | b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi | 3e-12 | |
| d1wj1a_ | 156 | b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 | 1e-11 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 1e-07 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 5e-07 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 8e-07 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 2e-06 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 4e-06 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 2e-05 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 2e-05 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 3e-05 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 3e-05 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 4e-05 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 4e-05 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 5e-05 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 5e-05 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 6e-05 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 9e-05 | |
| d1oy2a_ | 191 | b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap | 9e-05 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 1e-04 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 2e-04 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 2e-04 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 4e-04 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 7e-04 | |
| d2cy5a1 | 129 | b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M | 9e-04 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 0.003 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 0.003 |
| >d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Phosphotyrosine-binding domain (PTB) domain: Tensin species: Human (Homo sapiens) [TaxId: 9606]
Score = 109 bits (273), Expect = 9e-30
Identities = 62/106 (58%), Positives = 76/106 (71%), Gaps = 1/106 (0%)
Query: 186 ITSAQLLLAQGAACNVLYLVSVDTESLTGPQAVTRAINSLFGTKPLPHAAVVHFKVSSQG 245
+++A LL QGAAC+VLYL SV+TESLTGPQAV RA ++ P P AVVHFKVS+QG
Sbjct: 1 MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQG 60
Query: 246 ITLTDNKRQLFFRRHYPVASISYCGLDPEDSRCLTRPWCISKSHCS 291
ITLTDN+R+LFFRRHYPV SI++ DP+D R T P +
Sbjct: 61 ITLTDNQRKLFFRRHYPVNSITFSSTDPQD-RRWTNPDGTTSKIFG 105
|
| >d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 | Back information, alignment and structure |
|---|
| >d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 | Back information, alignment and structure |
|---|
| >d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 | Back information, alignment and structure |
|---|
| >d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 | Back information, alignment and structure |
|---|
| >d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 | Back information, alignment and structure |
|---|
| >d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 | Back information, alignment and structure |
|---|
| >d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| d1poca_ | 134 | Phospholipase A2 {European honeybee (Apis mellifer | 100.0 | |
| d2dkqa1 | 147 | Tensin {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1wvha1 | 133 | Tensin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.91 | |
| d1wgua_ | 136 | Amyloid beta A4 precursor protein-binding family B | 99.39 | |
| d1ntva_ | 152 | Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T | 99.18 | |
| d1p3ra_ | 148 | Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T | 99.06 | |
| d1ddma_ | 135 | Numb {Fruit fly (Drosophila melanogaster) [TaxId: | 99.02 | |
| d1wj1a_ | 156 | Numb {Mouse (Mus musculus) [TaxId: 10090]} | 99.0 | |
| d2cy5a1 | 129 | EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) | 98.19 | |
| d1oy2a_ | 191 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 98.11 | |
| d1aqca_ | 166 | X11 {Human (Homo sapiens) [TaxId: 9606]} | 97.61 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 96.17 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 96.17 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 96.07 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 95.99 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 95.7 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 95.63 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 95.54 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 95.39 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 95.36 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 95.36 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 95.04 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 94.8 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 94.37 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 94.08 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 93.99 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 93.77 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 93.73 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 93.66 | |
| d1n28a_ | 124 | Phospholipase A2 {Human (Homo sapiens), synovial f | 93.36 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 92.88 | |
| d1ae7a_ | 119 | Snake phospholipase A2 {Mainland tiger snake (Note | 92.58 | |
| d1buna_ | 120 | Snake phospholipase A2 {Many-banded krait (Bungaru | 92.49 | |
| d1le6a_ | 123 | Phospholipase A2 {Human (Homo sapiens), SPLA2 [Tax | 92.39 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 92.33 | |
| d1m8ta_ | 119 | Snake phospholipase A2 {King cobra (Ophiophagus ha | 92.26 | |
| d1g0za_ | 118 | Snake phospholipase A2 {Indian krait (Bungarus cae | 92.24 | |
| d1sz8a_ | 119 | Snake phospholipase A2 {Andaman cobra (Naja sagitt | 91.96 | |
| d1g4ia_ | 123 | Phospholipase A2 {Cow (Bos taurus), pancreas [TaxI | 91.66 | |
| d1zlba1 | 122 | Snake phospholipase A2 {Jararacussu (Bothrops jara | 91.64 | |
| d1oz6a_ | 120 | Snake phospholipase A2 {Saw-scaled viper (Echis ca | 91.6 | |
| d1p7oa_ | 124 | Snake phospholipase A2 {Small-eye snake (Micropech | 91.0 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 90.88 | |
| d1jltb_ | 122 | Snake phospholipase A2 {Sand viper (Vipera ammodyt | 90.13 | |
| d2g58a1 | 121 | Snake phospholipase A2 {Snake (Daboia russellii pu | 90.1 | |
| d1m8ra_ | 124 | Snake phospholipase A2 {Snake (Agkistrodon halys) | 89.94 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 89.53 | |
| d1jlta_ | 122 | Snake phospholipase A2 {Sand viper (Vipera ammodyt | 89.32 | |
| d1gmza_ | 122 | Snake phospholipase A2 {Snake (Bothrops pirajai), | 89.28 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 89.27 | |
| d1vipa_ | 121 | Snake phospholipase A2 {Russell's viper (Vipera ru | 89.2 | |
| d1jiaa_ | 122 | Snake phospholipase A2 {Snake (Agkistrodon halys) | 89.0 | |
| d1ppaa_ | 121 | Snake phospholipase A2 {Eastern cottonmouth snake | 88.82 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 88.59 | |
| d1mc2a_ | 122 | Snake phospholipase A2 {Hundred-pace snake (Agkist | 88.5 | |
| d1bjja_ | 122 | Snake phospholipase A2 {Snake (Agkistrodon halys) | 88.34 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 88.02 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 84.73 |
| >d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Phospholipase A2, PLA2 superfamily: Phospholipase A2, PLA2 family: Insect phospholipase A2 domain: Phospholipase A2 species: European honeybee (Apis mellifera) [TaxId: 7460]
Probab=100.00 E-value=3.7e-35 Score=250.71 Aligned_cols=55 Identities=40% Similarity=0.803 Sum_probs=52.7
Q ss_pred cccCCccccCCCCCCCCccCCCCccccchhhccccCCccccccCcccccccCCCC
Q psy10618 63 GIIPGTKWCGTGDIADTYFDLGSEIKLDKCCRTHDLCPSKIRAHTNRYNITNDSM 117 (339)
Q Consensus 63 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~kygLtN~sg 117 (339)
.|+|||||||+||+|.+|+|||.+.++|+|||+||+||++|+++++||||+|.+.
T Consensus 1 ~i~PGTkWCG~Gn~A~~~~dlG~~~~~D~CCR~HD~Cp~~I~~~~~k~gl~N~~~ 55 (134)
T d1poca_ 1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTAS 55 (134)
T ss_dssp CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSS
T ss_pred CccCCCeecCCCCCCCCcccccCccccchhhHhHccCcccccccccccceecCCc
Confidence 4899999999999999999999999999999999999999999999999999643
|
| >d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} | Back information, alignment and structure |
|---|
| >d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} | Back information, alignment and structure |
|---|
| >d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} | Back information, alignment and structure |
|---|
| >d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} | Back information, alignment and structure |
|---|
| >d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} | Back information, alignment and structure |
|---|
| >d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} | Back information, alignment and structure |
|---|
| >d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} | Back information, alignment and structure |
|---|
| >d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} | Back information, alignment and structure |
|---|
| >d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} | Back information, alignment and structure |
|---|
| >d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} | Back information, alignment and structure |
|---|
| >d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} | Back information, alignment and structure |
|---|
| >d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|