Diaphorina citri psyllid: psy10625


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MSEFARMEVEDLFIDLADGTFFFLFFKSKPYPNQIYSHFQARMEVEDLFIDLADGKKLLKLLEIISGEKLGKPNNGKMRVHKVENVNKSLAFLHTKPGERRPSK
ccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccccccc
*******EVEDLFIDLADGTFFFLFFKSKPYPNQIYSHFQARMEVEDLFIDLADGKKLLKLLEIISGE*********MRVHKVENVNKSLAFLHTK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEFARMEVEDLFIDLADGTFFFLFFKSKPYPNQIYSHFQARMEVEDLFIDLADGKKLLKLLEIISGEKLGKPNNGKMRVHKVENVNKSLAFLHTKPGERRPSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-actinin-1 F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.confidentQ9Z1P2
Alpha-actinin-1 F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.confidentP12814
Alpha-actinin-1 F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.confidentQ7TPR4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022607 [BP]cellular component assemblyprobableGO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0030864 [CC]cortical actin cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044444, GO:0071944, GO:0044422, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0044464, GO:0043226, GO:0044448
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0032432 [CC]actin filament bundleprobableGO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SJJ, chain A
Confidence level:very confident
Coverage over the Query: 22-100
View the alignment between query and template
View the model in PyMOL