Diaphorina citri psyllid: psy10626

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----

MRKDLKRAESMKADLTKKPKRTPSFTTRRRTQSFRKLQKLEQLDQLPPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEKKKTSIFEEEVGPGGYINSDGYSNLRNNHTSYEELPSPHSEPPPLPQTAPPQKHISPNNTPQRNPWPSDMNSYGHGTIYQNIGPPQHIGPPPTSLNNRQSVNNSKSSTLPPYVNPPYVKENSTRRPSESSSESEPTSVQRKDKRPNVLSSLFRKKKATHLII

cHHHHHHHHHHHcccccccccccccccccccccHHHHcccccccccccCEEEEEEEEEEEEcccccccccccccEEEEEEEccEEEEEEccccHHHcccccccEEEcccEEEEcccccccccEEEEECccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***************************************************QGVLERKHELQ*****AAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSL******************************************************************************************************************************************************************************K********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005912 [CC]	adherens junction	probable	GO:0005575, GO:0070161, GO:0030054
GO:0032432 [CC]	actin filament bundle	probable	GO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DRO, chain A
Confidence level:very confident
Coverage over the Query: 46-157
View the alignment between query and template
View the model in PyMOL

Template: 1F7C, chain A
Confidence level:probable
Coverage over the Query: 168-216
View the alignment between query and template
View the model in PyMOL