Psyllid ID: psy10626
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 344 | ||||||
| 328720391 | 4083 | PREDICTED: spectrin beta chain-like isof | 0.450 | 0.037 | 0.843 | 4e-84 | |
| 328720389 | 4047 | PREDICTED: spectrin beta chain-like isof | 0.450 | 0.038 | 0.843 | 4e-84 | |
| 328777761 | 4216 | PREDICTED: spectrin beta chain [Apis mel | 0.485 | 0.039 | 0.827 | 1e-78 | |
| 340717274 | 4143 | PREDICTED: spectrin beta chain, brain 4- | 0.491 | 0.040 | 0.817 | 3e-78 | |
| 340717276 | 4224 | PREDICTED: spectrin beta chain, brain 4- | 0.491 | 0.040 | 0.817 | 3e-78 | |
| 350407651 | 4247 | PREDICTED: spectrin beta chain, brain 4- | 0.491 | 0.039 | 0.817 | 3e-78 | |
| 383856370 | 4280 | PREDICTED: spectrin beta chain, brain 4- | 0.485 | 0.039 | 0.827 | 7e-78 | |
| 307173781 | 4197 | Spectrin beta chain, brain 4 [Camponotus | 0.485 | 0.039 | 0.821 | 6e-77 | |
| 345481110 | 4271 | PREDICTED: spectrin beta chain, brain 1- | 0.485 | 0.039 | 0.821 | 2e-76 | |
| 242020108 | 4215 | Spectrin beta chain, putative [Pediculus | 0.485 | 0.039 | 0.730 | 8e-72 |
| >gi|328720391|ref|XP_001946129.2| PREDICTED: spectrin beta chain-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 317 bits (813), Expect = 4e-84, Method: Compositional matrix adjust.
Identities = 146/173 (84%), Positives = 161/173 (93%)
Query: 1 MRKDLKRAESMKADLTKKPKRTPSFTTRRRTQSFRKLQKLEQLDQLPPVEIQGVLERKHE 60
++KD+KRAESMKAD+ KKPKRTPSFTTRRRTQSFRKLQKLE +DQLPPVEIQG L+RKHE
Sbjct: 3699 LKKDVKRAESMKADVYKKPKRTPSFTTRRRTQSFRKLQKLENVDQLPPVEIQGFLDRKHE 3758
Query: 61 LQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKR 120
LQS GKKAAVRSWK+ YTVLCGQLLCFFKDQ+DFV+SKAATSPII+FKA+CEKA DYTKR
Sbjct: 3759 LQSTGKKAAVRSWKTFYTVLCGQLLCFFKDQEDFVSSKAATSPIIVFKAKCEKAFDYTKR 3818
Query: 121 KHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVS 173
KHVFRL CTDGSEFLFLA + ME+WVNKI+FHAQLPPSLQLLSYDD+QK S
Sbjct: 3819 KHVFRLCCTDGSEFLFLADTSKEMEEWVNKITFHAQLPPSLQLLSYDDNQKGS 3871
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328720389|ref|XP_003247015.1| PREDICTED: spectrin beta chain-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328777761|ref|XP_396777.4| PREDICTED: spectrin beta chain [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340717274|ref|XP_003397110.1| PREDICTED: spectrin beta chain, brain 4-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340717276|ref|XP_003397111.1| PREDICTED: spectrin beta chain, brain 4-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350407651|ref|XP_003488149.1| PREDICTED: spectrin beta chain, brain 4-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383856370|ref|XP_003703682.1| PREDICTED: spectrin beta chain, brain 4-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307173781|gb|EFN64568.1| Spectrin beta chain, brain 4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345481110|ref|XP_001606391.2| PREDICTED: spectrin beta chain, brain 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242020108|ref|XP_002430498.1| Spectrin beta chain, putative [Pediculus humanus corporis] gi|212515655|gb|EEB17760.1| Spectrin beta chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 344 | ||||||
| FB|FBgn0004167 | 4337 | kst "karst" [Drosophila melano | 0.537 | 0.042 | 0.552 | 2.9e-45 | |
| WB|WBGene00004855 | 4166 | sma-1 [Caenorhabditis elegans | 0.377 | 0.031 | 0.492 | 1.1e-29 | |
| UNIPROTKB|F1ND51 | 2364 | SPTBN1 "Uncharacterized protei | 0.296 | 0.043 | 0.405 | 1.6e-15 | |
| MGI|MGI:98388 | 2363 | Sptbn1 "spectrin beta, non-ery | 0.313 | 0.045 | 0.390 | 2e-15 | |
| UNIPROTKB|F1LRX5 | 2310 | Sptbn1 "Protein Sptbn1" [Rattu | 0.313 | 0.046 | 0.381 | 1.3e-14 | |
| UNIPROTKB|F1PXT8 | 2351 | SPTBN1 "Uncharacterized protei | 0.313 | 0.045 | 0.390 | 1.3e-14 | |
| UNIPROTKB|F1MYC9 | 2363 | SPTBN1 "Uncharacterized protei | 0.313 | 0.045 | 0.390 | 1.3e-14 | |
| UNIPROTKB|G3V6S0 | 2363 | Sptbn1 "Protein Sptbn1" [Rattu | 0.313 | 0.045 | 0.381 | 1.3e-14 | |
| UNIPROTKB|F1PXU1 | 2364 | SPTBN1 "Uncharacterized protei | 0.313 | 0.045 | 0.390 | 1.3e-14 | |
| UNIPROTKB|Q01082 | 2364 | SPTBN1 "Spectrin beta chain, n | 0.313 | 0.045 | 0.390 | 1.3e-14 |
| FB|FBgn0004167 kst "karst" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 495 (179.3 bits), Expect = 2.9e-45, P = 2.9e-45
Identities = 105/190 (55%), Positives = 124/190 (65%)
Query: 4 DLKRAESMKADLXXXXXXXXXXXXXXXXXXXXXLQKLEQLDQLPPVEIQGVLERKHELQS 63
++KRAESMK QK E D LPPVEIQG LERKH LQS
Sbjct: 3756 NVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKN-QKGEGFD-LPPVEIQGSLERKHGLQS 3813
Query: 64 GGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHV 123
GGKKA VRSWK +TVLCGQL+CFFKD++DF+ K AT+P+ I A+CE+A DYTK+K+V
Sbjct: 3814 GGKKAPVRSWKQFHTVLCGQLVCFFKDENDFLQQKTATAPVNILGAKCERADDYTKKKYV 3873
Query: 124 FRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEK 183
FRL DGSEFLF APS ++ DWV KISFHA LPP++QLLSYD+S K + I
Sbjct: 3874 FRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLPPNMQLLSYDESMKQQSSSSPDI--- 3930
Query: 184 KKTSIFEEEV 193
K TS E V
Sbjct: 3931 KVTSSVESPV 3940
|
|
| WB|WBGene00004855 sma-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ND51 SPTBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98388 Sptbn1 "spectrin beta, non-erythrocytic 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LRX5 Sptbn1 "Protein Sptbn1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXT8 SPTBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MYC9 SPTBN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6S0 Sptbn1 "Protein Sptbn1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXU1 SPTBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q01082 SPTBN1 "Spectrin beta chain, non-erythrocytic 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 344 | |||
| cd10571 | 105 | cd10571, PH_beta_spectrin, Beta-spectrin pleckstri | 1e-52 | |
| cd01253 | 113 | cd01253, PH_ARHGAP21-like, ARHGAP21 and related pr | 2e-21 | |
| cd13295 | 126 | cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckst | 3e-19 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 3e-12 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 4e-12 | |
| cd13233 | 110 | cd13233, PH_ARHGAP9-like, Beta-spectrin pleckstrin | 2e-09 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 3e-07 | |
| cd13326 | 90 | cd13326, PH_CNK_insect-like, Connector enhancer of | 8e-06 | |
| cd01230 | 127 | cd01230, PH1_Tiam1_2, T-lymphoma invasion and meta | 4e-05 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 3e-04 | |
| cd13267 | 125 | cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub | 6e-04 | |
| cd10573 | 96 | cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin | 7e-04 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 0.001 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 0.002 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 0.003 |
| >gnl|CDD|241307 cd10571, PH_beta_spectrin, Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Score = 168 bits (429), Expect = 1e-52
Identities = 57/105 (54%), Positives = 69/105 (65%), Gaps = 1/105 (0%)
Query: 51 IQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDF-VASKAATSPIIIFKA 109
++G LERKHEL+SGGKKA+ RSWK +Y VL GQ L F+KDQ S A P+ + A
Sbjct: 1 MEGFLERKHELESGGKKASNRSWKKVYCVLKGQELSFYKDQKAAASESYAGEPPLNLSGA 60
Query: 110 RCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFH 154
CE A DY K+KHVFRL +DGSE+LF A E M DWV K+
Sbjct: 61 VCEVASDYKKKKHVFRLRLSDGSEYLFQAKDEEEMNDWVQKLQAA 105
|
Beta spectrin binds actin and functions as a major component of the cytoskeleton underlying cellular membranes. Beta spectrin consists of multiple spectrin repeats followed by a PH domain, which binds to inositol-1,4,5-trisphosphate. The PH domain of beta-spectrin is thought to play a role in the association of spectrin with the plasma membrane of cells. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 105 |
| >gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241449 cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241387 cd13233, PH_ARHGAP9-like, Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241264 cd01230, PH1_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2 Pleckstrin Homology (PH) domain, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 344 | |||
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.94 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.94 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.9 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.79 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.75 | |
| KOG0932|consensus | 774 | 99.73 | ||
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.69 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.69 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.69 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.68 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.67 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.67 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.67 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.66 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.65 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.63 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.62 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.6 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.6 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.56 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.51 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.49 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.48 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.44 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.37 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.33 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.26 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.25 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.23 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.07 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.07 | |
| KOG0930|consensus | 395 | 99.01 | ||
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.91 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 98.86 | |
| KOG4407|consensus | 1973 | 98.81 | ||
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.64 | |
| KOG0517|consensus | 2473 | 98.63 | ||
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 98.57 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.45 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 98.39 | |
| KOG0690|consensus | 516 | 98.37 | ||
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.36 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 98.27 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 98.25 | |
| KOG3640|consensus | 1116 | 98.24 | ||
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 98.24 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 98.11 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 98.01 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 97.95 | |
| KOG2059|consensus | 800 | 97.94 | ||
| KOG1451|consensus | 812 | 97.76 | ||
| KOG1090|consensus | 1732 | 97.68 | ||
| KOG3751|consensus | 622 | 97.59 | ||
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 97.56 | |
| KOG0521|consensus | 785 | 97.54 | ||
| KOG3531|consensus | 1036 | 97.38 | ||
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 97.14 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 97.08 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 97.04 | |
| PLN02866 | 1068 | phospholipase D | 96.99 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 96.97 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 96.92 | |
| KOG1117|consensus | 1186 | 96.84 | ||
| KOG3723|consensus | 851 | 96.64 | ||
| cd04388 | 200 | RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator pr | 96.52 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 96.2 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 96.0 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 95.94 | |
| KOG1738|consensus | 638 | 95.92 | ||
| KOG3549|consensus | 505 | 95.8 | ||
| KOG1117|consensus | 1186 | 95.71 | ||
| cd04382 | 193 | RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase- | 95.68 | |
| cd04390 | 199 | RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPas | 95.55 | |
| cd04383 | 188 | RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activato | 95.5 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 95.27 | |
| cd04408 | 200 | RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator | 95.2 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 95.19 | |
| cd04372 | 194 | RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase- | 95.18 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 95.05 | |
| cd04376 | 206 | RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-acti | 95.03 | |
| cd04379 | 207 | RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator | 95.0 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 94.91 | |
| cd04409 | 211 | RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activato | 94.9 | |
| cd04381 | 182 | RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activa | 94.78 | |
| KOG0248|consensus | 936 | 94.57 | ||
| KOG3523|consensus | 695 | 94.35 | ||
| cd04407 | 186 | RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPas | 94.26 | |
| cd04378 | 203 | RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPas | 94.19 | |
| cd04396 | 225 | RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPas | 93.99 | |
| KOG4424|consensus | 623 | 93.83 | ||
| cd04406 | 186 | RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPas | 93.76 | |
| cd04387 | 196 | RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator pr | 93.7 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 93.46 | |
| cd04397 | 213 | RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activato | 93.2 | |
| KOG3543|consensus | 1218 | 92.94 | ||
| KOG2070|consensus | 661 | 92.92 | ||
| cd04373 | 185 | RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator | 92.64 | |
| cd04403 | 187 | RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: G | 92.37 | |
| KOG1739|consensus | 611 | 92.23 | ||
| PF15411 | 116 | PH_10: Pleckstrin homology domain | 92.02 | |
| cd04385 | 184 | RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator | 91.8 | |
| cd04386 | 203 | RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activa | 91.78 | |
| cd04391 | 216 | RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-ac | 91.68 | |
| cd04374 | 203 | RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein | 91.44 | |
| cd04375 | 220 | RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator | 91.29 | |
| cd04384 | 195 | RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activato | 91.2 | |
| cd04395 | 196 | RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-ac | 91.05 | |
| cd04398 | 192 | RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activato | 90.99 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 90.53 | |
| cd04380 | 220 | RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activato | 89.65 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 89.13 | |
| cd04400 | 190 | RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activato | 88.66 | |
| cd04377 | 186 | RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase- | 88.56 | |
| cd04392 | 208 | RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-ac | 88.51 | |
| cd04389 | 187 | RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator | 88.37 | |
| cd04402 | 192 | RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-ac | 88.26 | |
| cd04393 | 189 | RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-ac | 87.78 | |
| cd04404 | 195 | RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase- | 87.75 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 87.61 | |
| cd04394 | 202 | RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase- | 87.27 | |
| cd00159 | 169 | RhoGAP RhoGAP: GTPase-activator protein (GAP) for | 87.22 | |
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 85.57 | |
| KOG4269|consensus | 1112 | 82.77 | ||
| KOG1737|consensus | 799 | 82.16 | ||
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 81.61 | |
| smart00324 | 174 | RhoGAP GTPase-activator protein for Rho-like GTPas | 81.4 | |
| KOG1264|consensus | 1267 | 81.19 | ||
| PF00620 | 151 | RhoGAP: RhoGAP domain; InterPro: IPR000198 Members | 81.07 |
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
Probab=99.94 E-value=3.9e-27 Score=198.59 Aligned_cols=107 Identities=50% Similarity=0.800 Sum_probs=82.8
Q ss_pred EEEEEEeeeeeeccCCccc--cccCCceEEEEEeCCeEeEEecCchhhccc----------CCCccEEecccEEEecCCC
Q psy10626 50 EIQGVLERKHELQSGGKKA--AVRSWKSLYTVLCGQLLCFFKDQDDFVASK----------AATSPIIIFKARCEKAGDY 117 (344)
Q Consensus 50 ~KeGwL~RKq~lesgGKKs--~~RsWKkrwfVLrG~~L~fYKDeke~a~~~----------a~~~~IsL~ga~v~ia~dy 117 (344)
+|+|||.||++++.+|||. ..|+|+.+|+||+|+.|+||||+....... .+...|+|.+|.|+++.||
T Consensus 1 ~keG~l~RK~~~~~~gkk~~~~~R~Wk~~y~vL~g~~L~~~k~~~~~~~~~~~~~~~~~~~~p~~~i~L~~a~a~~a~dY 80 (119)
T PF15410_consen 1 YKEGILMRKHELESGGKKASRSKRSWKQVYAVLQGGQLYFYKDEKSPASSTPPDIQSVENAKPDSSISLHHALAEIASDY 80 (119)
T ss_dssp --EEEEEEEEEEECTTCC---S---EEEEEEEEETTEEEEESSHHHHCCT-BS---SS--E-----EE-TT-EEEEETTB
T ss_pred CceEEEEEEEEEcCCCCCcCCCCCCccEEeEEEECCEEEEEccCcccccCCcccccccccCcceeEEEecceEEEeCccc
Confidence 4899999999999999999 799999999999999999999966533221 1234599999999999999
Q ss_pred CCCcceEEEEeCCCcEEEEECCCHHHHHHHHHHHHHhhC
Q psy10626 118 TKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQ 156 (344)
Q Consensus 118 ~KRKnVFrL~tpdg~eyLFqAeSeeEM~eWI~AIr~aaa 156 (344)
+||+|||+|+++||.+|||||.|++||++||.+||.+|+
T Consensus 81 ~Kr~~VFrL~~~dg~e~Lfqa~~~~~m~~Wi~~IN~~AA 119 (119)
T PF15410_consen 81 TKRKNVFRLRTADGSEYLFQASDEEEMNEWIDAINYAAA 119 (119)
T ss_dssp TTCSSEEEEE-TTS-EEEEE-SSHHHHHHHHHHHHHH--
T ss_pred ccCCeEEEEEeCCCCEEEEECCCHHHHHHHHHHHhhhcC
Confidence 999999999999999999999999999999999999885
|
|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase) | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >cd04382 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins | Back alignment and domain information |
|---|
| >cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04408 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins | Back alignment and domain information |
|---|
| >cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd04409 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >cd04407 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB | Back alignment and domain information |
|---|
| >cd04378 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) | Back alignment and domain information |
|---|
| >cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA | Back alignment and domain information |
|---|
| >cd04387 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04397 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins | Back alignment and domain information |
|---|
| >KOG3543|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >cd04373 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins | Back alignment and domain information |
|---|
| >cd04403 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains | Back alignment and domain information |
|---|
| >KOG1739|consensus | Back alignment and domain information |
|---|
| >PF15411 PH_10: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs | Back alignment and domain information |
|---|
| >cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins | Back alignment and domain information |
|---|
| >cd04391 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins | Back alignment and domain information |
|---|
| >cd04374 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins | Back alignment and domain information |
|---|
| >cd04375 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins | Back alignment and domain information |
|---|
| >cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA | Back alignment and domain information |
|---|
| >cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins | Back alignment and domain information |
|---|
| >cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >cd04380 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in OCRL1-like proteins | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins | Back alignment and domain information |
|---|
| >cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins | Back alignment and domain information |
|---|
| >cd04392 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins | Back alignment and domain information |
|---|
| >cd04389 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain | Back alignment and domain information |
|---|
| >cd04402 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins | Back alignment and domain information |
|---|
| >cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins | Back alignment and domain information |
|---|
| >cd04404 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd04394 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins | Back alignment and domain information |
|---|
| >cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG4269|consensus | Back alignment and domain information |
|---|
| >KOG1737|consensus | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >PF00620 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 344 | ||||
| 1btn_A | 106 | Structure Of The Binding Site For Inositol Phosphat | 9e-16 | ||
| 1wjm_A | 123 | Solution Structure Of Pleckstrin Homology Domain Of | 3e-15 | ||
| 1dro_A | 122 | Nmr Structure Of The CytoskeletonSIGNAL TRANSDUCTIO | 5e-12 | ||
| 2j59_M | 168 | Crystal Structure Of The Arf1:arhgap21-Arfbd Comple | 4e-06 | ||
| 2dhj_A | 125 | Solution Structure Of The Ph Domain Of Rho Gtpase A | 1e-05 | ||
| 3pp2_A | 124 | Crystal Structure Of The Pleckstrin Homology Domain | 1e-04 |
| >pdb|1BTN|A Chain A, Structure Of The Binding Site For Inositol Phosphates In A Ph Domain Length = 106 | Back alignment and structure |
|
| >pdb|1WJM|A Chain A, Solution Structure Of Pleckstrin Homology Domain Of Human Beta Iii Spectrin Length = 123 | Back alignment and structure |
| >pdb|1DRO|A Chain A, Nmr Structure Of The CytoskeletonSIGNAL TRANSDUCTION Protein Length = 122 | Back alignment and structure |
| >pdb|2J59|M Chain M, Crystal Structure Of The Arf1:arhgap21-Arfbd Complex Length = 168 | Back alignment and structure |
| >pdb|2DHJ|A Chain A, Solution Structure Of The Ph Domain Of Rho Gtpase Activating Protein 21 From Human Length = 125 | Back alignment and structure |
| >pdb|3PP2|A Chain A, Crystal Structure Of The Pleckstrin Homology Domain Of Arhgap27 Length = 124 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 344 | |||
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 2e-38 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 1e-37 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 2e-33 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 6e-33 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 2e-31 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 9e-28 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 9e-25 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 4e-23 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 3e-20 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 3e-15 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 5e-15 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 4e-12 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 7e-12 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 2e-11 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 2e-11 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 4e-11 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 5e-11 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 6e-11 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 7e-11 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 2e-09 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 4e-09 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 7e-09 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 9e-09 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 9e-08 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 2e-07 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 3e-07 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 5e-07 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 6e-07 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 1e-06 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 2e-06 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 2e-06 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 5e-06 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 6e-06 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 6e-06 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 1e-05 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 1e-05 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 1e-05 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 1e-05 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 3e-05 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 4e-05 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 7e-05 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 9e-05 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 1e-04 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 1e-04 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 1e-04 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 1e-04 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 2e-04 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 2e-04 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 5e-04 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 5e-04 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 7e-04 |
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
Score = 132 bits (333), Expect = 2e-38
Identities = 44/116 (37%), Positives = 64/116 (55%), Gaps = 2/116 (1%)
Query: 47 PPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKA--ATSPI 104
+++G+L RK E+++ GKKAA RSW+++Y VL L F+KD A P+
Sbjct: 6 SGEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPV 65
Query: 105 IIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPS 160
+ +A+ A DY KRKHVF+L DG E+LF A E M W+ ++ PS
Sbjct: 66 SLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIASGPS 121
|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 136 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 344 | |||
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.94 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.93 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.92 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.91 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.9 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.9 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.87 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.85 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.85 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.81 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.81 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.79 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.79 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.79 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.79 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.79 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.78 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.78 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.78 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.78 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.77 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.77 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.77 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.77 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.77 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.76 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.75 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.75 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.75 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.75 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.75 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.74 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.74 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.73 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.73 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.72 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.72 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.72 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.72 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.71 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.7 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.7 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.7 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.7 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.69 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.68 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.68 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.68 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.68 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.67 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.67 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.61 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.59 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.58 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.58 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.57 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.57 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.52 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.47 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.43 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.41 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.39 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.3 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.25 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.17 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.14 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.13 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.1 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 98.63 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.51 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.49 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 98.48 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 98.48 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 97.86 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 97.53 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 97.44 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 97.26 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 97.17 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.09 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 97.07 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 96.98 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.95 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 96.92 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 96.91 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.88 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 96.83 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 96.7 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 96.69 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 96.69 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 96.57 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 96.48 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 96.37 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 96.21 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 96.04 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 95.97 | |
| 2ovj_A | 201 | Mgcracgap, RAC GTPase-activating protein 1; signal | 95.63 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 95.52 | |
| 1f7c_A | 231 | Rhogap protein; GTPase activating protein, RHO GTP | 95.28 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 95.24 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 95.05 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 94.93 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 94.31 | |
| 1pbw_A | 216 | Rhogap domain, phosphatidylinositol 3-kinase; phos | 93.7 | |
| 1tx4_A | 198 | P50-rhogap; complex (GTPase activation/proto-oncog | 93.51 | |
| 2osa_A | 202 | N-chimaerin; RHO-GAP, GTPase activation, structura | 93.27 | |
| 3kuq_A | 228 | RHO GTPase-activating protein 7; structural genomi | 92.82 | |
| 2ee4_A | 209 | RHO GTPase activating protein 5 variant; all alpha | 92.64 | |
| 1ow3_A | 242 | RHO-GTPase-activating protein 1; complex, GTPase, | 92.5 | |
| 3byi_A | 214 | RHO GTPase activating protein 15; BM046, arhgap15, | 92.4 | |
| 3iug_A | 229 | RHO/CDC42/RAC GTPase-activating protein RICS; stru | 92.07 | |
| 3fk2_A | 246 | Glucocorticoid receptor DNA-binding factor 1; stru | 91.93 | |
| 3msx_B | 201 | RHO GTPase-activating protein 20; protein-proten c | 91.82 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 91.34 | |
| 2xs6_A | 214 | Phosphatidylinositol 3-kinase regulatory subunit; | 90.77 | |
| 3qis_A | 366 | Inositol polyphosphate 5-phosphatase OCRL-1; DENT | 88.6 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 88.02 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 83.12 |
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.94 E-value=1e-26 Score=193.67 Aligned_cols=109 Identities=31% Similarity=0.485 Sum_probs=94.4
Q ss_pred CCeEEEEEEeeeeeeccCCccccccCCceEEEEEeCCeEeEEecCchhhccc--------CCCccEEecccEEEecC-CC
Q psy10626 47 PPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASK--------AATSPIIIFKARCEKAG-DY 117 (344)
Q Consensus 47 ~~V~KeGwL~RKq~lesgGKKs~~RsWKkrwfVLrG~~L~fYKDeke~a~~~--------a~~~~IsL~ga~v~ia~-dy 117 (344)
+.|.|+|||.||++++. |||...++|+++||||+|+.|+||||+.+..... .+...|+|.+|.|+++. ++
T Consensus 6 ~~v~keG~L~rK~~~~~-gkk~~~r~W~~~w~VL~~~~L~~yKd~~~~~~~~~~~~~~~~~~~~~i~L~~a~v~~~~~d~ 84 (124)
T 3pp2_A 6 KTLDKAGVLHRTKTADK-GKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDK 84 (124)
T ss_dssp ---CEEEEEEEEEEEET-TEECSSCCCEEEEEEEETTEEEEESCSBCC---CBCCGGGGCSEEEEEECTTCEEEECCGGG
T ss_pred CcEEEEEEEEEEEeccC-CccCCCCCceEEEEEEECCEEEEEecCccccccCccCcccccCCcceEEcCCCEEEeccccc
Confidence 46999999999998876 9998889999999999999999999988653211 24678999999999986 89
Q ss_pred CCCcceEEEEeCCCcEEEEECCCHHHHHHHHHHHHHhhC
Q psy10626 118 TKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQ 156 (344)
Q Consensus 118 ~KRKnVFrL~tpdg~eyLFqAeSeeEM~eWI~AIr~aaa 156 (344)
.+|+|||+|++++|.+|+|||+|++||++||.+|+.|+.
T Consensus 85 ~krk~vF~l~t~~~~~ylfqA~s~~e~~~Wi~aI~~aI~ 123 (124)
T 3pp2_A 85 SSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQ 123 (124)
T ss_dssp CSSSSEEEEECTTSCEEEEECSCHHHHHHHHHHHHHHHC
T ss_pred CCCceEEEEECCCCCEEEEECCCHHHHHHHHHHHHHHHh
Confidence 999999999999999999999999999999999998864
|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 | Back alignment and structure |
|---|
| >1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* | Back alignment and structure |
|---|
| >2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A | Back alignment and structure |
|---|
| >1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* | Back alignment and structure |
|---|
| >3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 344 | ||||
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 1e-22 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 1e-20 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 1e-19 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 6e-19 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 2e-16 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 9e-10 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 1e-09 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-09 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 1e-08 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 2e-08 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 3e-07 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 5e-07 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 6e-07 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 2e-06 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 1e-05 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 1e-05 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 4e-05 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 9e-05 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 9e-05 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 1e-04 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 8e-04 |
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: beta-spectrin species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 89.6 bits (221), Expect = 1e-22
Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 4/113 (3%)
Query: 48 PVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAAT----SP 103
+G + RKHE S KKA+ RSW +Y + F+KDQ + ++ T
Sbjct: 7 GEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPS 66
Query: 104 IIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQ 156
+ A E A DYTK+KHV R+ +G+ FL A +T M WV + +
Sbjct: 67 YDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSD 119
|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 344 | |||
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.88 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.87 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.86 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.85 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.8 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.79 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.78 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.78 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.78 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.76 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.75 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.75 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.73 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.73 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.72 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.71 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.69 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.68 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.67 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.67 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.67 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.66 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.66 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.65 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.64 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.64 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.62 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.55 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.51 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 98.94 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.65 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.42 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 98.21 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.81 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 97.7 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.48 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 97.46 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 97.03 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.84 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 96.64 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 96.43 | |
| d1pbwa_ | 184 | p85 alpha subunit RhoGAP domain {Human (Homo sapie | 95.81 | |
| d1f7ca_ | 191 | Graf {Chicken (Gallus gallus) [TaxId: 9031]} | 94.22 | |
| d1xa6a1 | 196 | Beta-chimaerin, C-terminal domain {Human (Homo sap | 93.39 | |
| d1tx4a_ | 196 | p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 96 | 89.47 |
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: beta-spectrin species: Mouse (Mus musculus), brain [TaxId: 10090]
Probab=99.88 E-value=3.3e-22 Score=156.13 Aligned_cols=104 Identities=39% Similarity=0.704 Sum_probs=93.0
Q ss_pred EEEEEeeeeeeccCCccccccCCceEEEEEeCCeEeEEecCchhhcc--cCCCccEEecccEEEecCCCCCCcceEEEEe
Q psy10626 51 IQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVAS--KAATSPIIIFKARCEKAGDYTKRKHVFRLYC 128 (344)
Q Consensus 51 KeGwL~RKq~lesgGKKs~~RsWKkrwfVLrG~~L~fYKDeke~a~~--~a~~~~IsL~ga~v~ia~dy~KRKnVFrL~t 128 (344)
+||||.||++....+|+...++|+++||||+++.|+||+++.+.... ......|+|.+|.+..+.++.+++|+|.|.+
T Consensus 1 ~eG~L~rk~~~~~~~kk~~~~~Wk~r~~vL~~~~L~~yk~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~~~f~i~~ 80 (106)
T d1btna_ 1 MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRL 80 (106)
T ss_dssp CEEEEEEEEEECSTTCBCSCCCCEEEEEEEETTEEEEESSHHHHHHTCCSSSCCCEECTTCEEEECSSCCSSSSEEEEEC
T ss_pred CeeeEEEeeEccCCCcccCCCCCcEEEEEEECCEEEEEeChhhcccccccCcceeEEeccceeeeccccccCcceEeecc
Confidence 58999999999999999989999999999999999999998764432 2345679999999888888889999999999
Q ss_pred CCCcEEEEECCCHHHHHHHHHHHHHh
Q psy10626 129 TDGSEFLFLAPSETLMEDWVNKISFH 154 (344)
Q Consensus 129 pdg~eyLFqAeSeeEM~eWI~AIr~a 154 (344)
.++.+|+|+|+|++||++||.+|+.|
T Consensus 81 ~~~~~~~~~a~s~~e~~~W~~ai~~A 106 (106)
T d1btna_ 81 SDGNEYLFQAKDDEEMNTWIQAISSA 106 (106)
T ss_dssp TTSCEEEEECSSHHHHHHHHHHHHHC
T ss_pred cCCCEEEEECCCHHHHHHHHHHHHhC
Confidence 99999999999999999999999865
|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|