Psyllid ID: psy10626


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MRKDLKRAESMKADLTKKPKRTPSFTTRRRTQSFRKLQKLEQLDQLPPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEKKKTSIFEEEVGPGGYINSDGYSNLRNNHTSYEELPSPHSEPPPLPQTAPPQKHISPNNTPQRNPWPSDMNSYGHGTIYQNIGPPQHIGPPPTSLNNRQSVNNSKSSTLPPYVNPPYVKENSTRRPSESSSESEPTSVQRKDKRPNVLSSLFRKKKATHLII
cHHHHHHHHHHHcccccccccccccccccccccHHHHcccccccccccEEEEEEEEEEEEEcccccccccccccEEEEEEEccEEEEEEcccHHHHcccccccEEEcccEEEEcccccccccEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHccccHcHccccccccccccccccccccccccccccccccccccEEccEEEEcEcccccccccccccccEEEEEEcccEEEEEEccccHHHcccccccEEccccEEEEcccccccccEEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccEEEcEEEccccccccccccccccccccccHHHHHHHHHccccccc
MRKDLKRAESMKadltkkpkrtpsfttrrRTQSFRKLQkleqldqlppveiQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLcffkdqddfvaskaatspIIIFKARCEkagdytkrkhVFRLYctdgseflflapsetlMEDWVNKISfhaqlppslqllsyddsqkvsqytgttiqekkktsifeeevgpggyinsdgysnlrnnhtsyeelpsphseppplpqtappqkhispnntpqrnpwpsdmnsyghgtiyqnigppqhigppptslnnrqsvnnsksstlppyvnppyvkenstrrpsessseseptsvqrkdkrpnvlSSLFRKkkathlii
mrkdlkraesmkadltkkpkrtpsfttrrrtqsfrklqkleqldqlppvEIQGVLerkhelqsggkkaavrSWKSLYTVLCGQLLCFFKDQDDFVAskaatspiiifkarcekagdytkRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTgttiqekkktsifeeevgpggYINSDGYSNLRNNHTSYEELPSPHSEPPPLPQTAPPQKHISPNNTPQRNPWPSDMNSYGHGTIYQNIGPPQHIGPPPTSLNNRQSVNnsksstlppyvnppyvkenstrrpsessseseptsvqrkdkrpnvlsslfrkkkathlii
MRKDLKRAESMKADLtkkpkrtpsfttrrrtqsfrkLQKLEQLDQLPPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEKKKTSIFEEEVGPGGYINSDGYSNLRNNHTSYeelpsphseppplpqtappQKHISPNNTPQRNPWPSDMNSYGHGTIYQNIGPPQHIGPPPTSLNNRQSVNNSKSSTLPPYVNPPYVKENstrrpsessseseptsVQRKDKRPNVLSSLFRKKKATHLII
*******************************************************************AAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSY**********************************************************************************************************************************************************************************
***************************************************QGVLERKHELQ*****AA*RSWKSLYTVLCGQLLCFF****************IIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFH*************************************************************************************************************************************************************************************KK***HLII
***********KADLTKKPKRTPSFTTRRRTQSFRKLQKLEQLDQLPPVEIQGVLER************VRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEKKKTSIFEEEVGPGGYINSDGYSNLRNNHTS*********************KHISPNNTPQRNPWPSDMNSYGHGTIYQNIGPPQHIGPPPTSLNNRQSVNNSKSSTLPPYVNPPYV**************************PNVLSSLFRK********
*******************************************DQLPPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSL****************************************************************************************SDM*S*GHGTIYQN**PPQHIGPPPT*******************VNPPYVKENSTRR*************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKDLKRAESMKADLTKKPKRTPSFTTRRRTQSFRKLQKLEQLDQLPPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEKKKTSIFEEEVGPGGYINSDGYSNLRNNHTSYEELPSPHSEPPPLPQTAPPQKHISPNNTPQRNPWPSDMNSYGHGTIYQNIGPPQHIGPPPTSLNNRQSVNNSKSSTLPPYVNPPYVKENSTRRPSESSSESEPTSVQRKDKRPNVLSSLFRKKKATHLII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
Q622612363 Spectrin beta chain, non- yes N/A 0.398 0.057 0.356 1e-16
Q010822364 Spectrin beta chain, non- yes N/A 0.398 0.057 0.349 2e-16
O150202390 Spectrin beta chain, non- no N/A 0.281 0.040 0.396 8e-13
Q9QWN82388 Spectrin beta chain, non- no N/A 0.281 0.040 0.378 1e-11
Q9H2542564 Spectrin beta chain, non- no N/A 0.299 0.040 0.415 2e-11
Q8NDX11056 PH and SEC7 domain-contai no N/A 0.401 0.130 0.293 2e-11
Q009632291 Spectrin beta chain OS=Dr no N/A 0.276 0.041 0.348 1e-09
Q8BLR51005 PH and SEC7 domain-contai no N/A 0.331 0.113 0.317 2e-09
Q9NRC63674 Spectrin beta chain, non- no N/A 0.281 0.026 0.371 9e-09
Q9BQI7771 PH and SEC7 domain-contai no N/A 0.308 0.137 0.333 2e-08
>sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 Back     alignment and function desciption
 Score = 87.4 bits (215), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 51/143 (35%), Positives = 78/143 (54%), Gaps = 6/143 (4%)

Query: 16   TKKPKRTPSFTTRRRTQSFRKLQKLEQLD----QLPPVEIQGVLERKHELQSGGKKAAVR 71
            +K+    PS T  R+ +S    Q    L     + P  +++G L RKHE ++  KKA+ R
Sbjct: 2160 SKESSPVPSPTLDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSR 2219

Query: 72   SWKSLYTVLCGQLLCFFKDQDDFVASKAATS--PIIIFKARCEKAGDYTKRKHVFRLYCT 129
            SW ++Y V+  Q + F+KD     +     S  P+ + +A CE A DY K+KHVF+L  +
Sbjct: 2220 SWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLS 2279

Query: 130  DGSEFLFLAPSETLMEDWVNKIS 152
            DG+E+LF A  +  M  W+  IS
Sbjct: 2280 DGNEYLFQAKDDEEMNTWIQAIS 2302




Fodrin, which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Mus musculus (taxid: 10090)
>sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 Back     alignment and function description
>sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 Back     alignment and function description
>sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 Back     alignment and function description
>sp|Q8NDX1|PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens GN=PSD4 PE=1 SV=2 Back     alignment and function description
>sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 Back     alignment and function description
>sp|Q8BLR5|PSD4_MOUSE PH and SEC7 domain-containing protein 4 OS=Mus musculus GN=Psd4 PE=2 SV=1 Back     alignment and function description
>sp|Q9NRC6|SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens GN=SPTBN5 PE=1 SV=1 Back     alignment and function description
>sp|Q9BQI7|PSD2_HUMAN PH and SEC7 domain-containing protein 2 OS=Homo sapiens GN=PSD2 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
328720391 4083 PREDICTED: spectrin beta chain-like isof 0.450 0.037 0.843 4e-84
328720389 4047 PREDICTED: spectrin beta chain-like isof 0.450 0.038 0.843 4e-84
328777761 4216 PREDICTED: spectrin beta chain [Apis mel 0.485 0.039 0.827 1e-78
340717274 4143 PREDICTED: spectrin beta chain, brain 4- 0.491 0.040 0.817 3e-78
340717276 4224 PREDICTED: spectrin beta chain, brain 4- 0.491 0.040 0.817 3e-78
350407651 4247 PREDICTED: spectrin beta chain, brain 4- 0.491 0.039 0.817 3e-78
383856370 4280 PREDICTED: spectrin beta chain, brain 4- 0.485 0.039 0.827 7e-78
307173781 4197 Spectrin beta chain, brain 4 [Camponotus 0.485 0.039 0.821 6e-77
345481110 4271 PREDICTED: spectrin beta chain, brain 1- 0.485 0.039 0.821 2e-76
242020108 4215 Spectrin beta chain, putative [Pediculus 0.485 0.039 0.730 8e-72
>gi|328720391|ref|XP_001946129.2| PREDICTED: spectrin beta chain-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  317 bits (813), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%)

Query: 1    MRKDLKRAESMKADLTKKPKRTPSFTTRRRTQSFRKLQKLEQLDQLPPVEIQGVLERKHE 60
            ++KD+KRAESMKAD+ KKPKRTPSFTTRRRTQSFRKLQKLE +DQLPPVEIQG L+RKHE
Sbjct: 3699 LKKDVKRAESMKADVYKKPKRTPSFTTRRRTQSFRKLQKLENVDQLPPVEIQGFLDRKHE 3758

Query: 61   LQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKR 120
            LQS GKKAAVRSWK+ YTVLCGQLLCFFKDQ+DFV+SKAATSPII+FKA+CEKA DYTKR
Sbjct: 3759 LQSTGKKAAVRSWKTFYTVLCGQLLCFFKDQEDFVSSKAATSPIIVFKAKCEKAFDYTKR 3818

Query: 121  KHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVS 173
            KHVFRL CTDGSEFLFLA +   ME+WVNKI+FHAQLPPSLQLLSYDD+QK S
Sbjct: 3819 KHVFRLCCTDGSEFLFLADTSKEMEEWVNKITFHAQLPPSLQLLSYDDNQKGS 3871




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328720389|ref|XP_003247015.1| PREDICTED: spectrin beta chain-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328777761|ref|XP_396777.4| PREDICTED: spectrin beta chain [Apis mellifera] Back     alignment and taxonomy information
>gi|340717274|ref|XP_003397110.1| PREDICTED: spectrin beta chain, brain 4-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340717276|ref|XP_003397111.1| PREDICTED: spectrin beta chain, brain 4-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350407651|ref|XP_003488149.1| PREDICTED: spectrin beta chain, brain 4-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383856370|ref|XP_003703682.1| PREDICTED: spectrin beta chain, brain 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307173781|gb|EFN64568.1| Spectrin beta chain, brain 4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345481110|ref|XP_001606391.2| PREDICTED: spectrin beta chain, brain 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242020108|ref|XP_002430498.1| Spectrin beta chain, putative [Pediculus humanus corporis] gi|212515655|gb|EEB17760.1| Spectrin beta chain, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
FB|FBgn0004167 4337 kst "karst" [Drosophila melano 0.537 0.042 0.552 2.9e-45
WB|WBGene000048554166 sma-1 [Caenorhabditis elegans 0.377 0.031 0.492 1.1e-29
UNIPROTKB|F1ND512364 SPTBN1 "Uncharacterized protei 0.296 0.043 0.405 1.6e-15
MGI|MGI:983882363 Sptbn1 "spectrin beta, non-ery 0.313 0.045 0.390 2e-15
UNIPROTKB|F1LRX52310 Sptbn1 "Protein Sptbn1" [Rattu 0.313 0.046 0.381 1.3e-14
UNIPROTKB|F1PXT82351 SPTBN1 "Uncharacterized protei 0.313 0.045 0.390 1.3e-14
UNIPROTKB|F1MYC92363 SPTBN1 "Uncharacterized protei 0.313 0.045 0.390 1.3e-14
UNIPROTKB|G3V6S02363 Sptbn1 "Protein Sptbn1" [Rattu 0.313 0.045 0.381 1.3e-14
UNIPROTKB|F1PXU12364 SPTBN1 "Uncharacterized protei 0.313 0.045 0.390 1.3e-14
UNIPROTKB|Q010822364 SPTBN1 "Spectrin beta chain, n 0.313 0.045 0.390 1.3e-14
FB|FBgn0004167 kst "karst" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 2.9e-45, P = 2.9e-45
 Identities = 105/190 (55%), Positives = 124/190 (65%)

Query:     4 DLKRAESMKADLXXXXXXXXXXXXXXXXXXXXXLQKLEQLDQLPPVEIQGVLERKHELQS 63
             ++KRAESMK                         QK E  D LPPVEIQG LERKH LQS
Sbjct:  3756 NVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKN-QKGEGFD-LPPVEIQGSLERKHGLQS 3813

Query:    64 GGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATSPIIIFKARCEKAGDYTKRKHV 123
             GGKKA VRSWK  +TVLCGQL+CFFKD++DF+  K AT+P+ I  A+CE+A DYTK+K+V
Sbjct:  3814 GGKKAPVRSWKQFHTVLCGQLVCFFKDENDFLQQKTATAPVNILGAKCERADDYTKKKYV 3873

Query:   124 FRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPSLQLLSYDDSQKVSQYTGTTIQEK 183
             FRL   DGSEFLF APS  ++ DWV KISFHA LPP++QLLSYD+S K    +   I   
Sbjct:  3874 FRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLPPNMQLLSYDESMKQQSSSSPDI--- 3930

Query:   184 KKTSIFEEEV 193
             K TS  E  V
Sbjct:  3931 KVTSSVESPV 3940




GO:0030707 "ovarian follicle cell development" evidence=TAS
GO:0007009 "plasma membrane organization" evidence=TAS
GO:0003779 "actin binding" evidence=ISS;IDA
GO:0008017 "microtubule binding" evidence=IDA
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0008091 "spectrin" evidence=ISS
GO:0016327 "apicolateral plasma membrane" evidence=TAS
GO:0045186 "zonula adherens assembly" evidence=TAS
GO:0000910 "cytokinesis" evidence=IMP
GO:0005543 "phospholipid binding" evidence=IEA
GO:0006897 "endocytosis" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0005912 "adherens junction" evidence=IDA
GO:0032432 "actin filament bundle" evidence=IDA
GO:0042060 "wound healing" evidence=IMP
GO:0010797 "regulation of multivesicular body size involved in endosome transport" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0032509 "endosome transport via multivesicular body sorting pathway" evidence=IMP
WB|WBGene00004855 sma-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND51 SPTBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:98388 Sptbn1 "spectrin beta, non-erythrocytic 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRX5 Sptbn1 "Protein Sptbn1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXT8 SPTBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYC9 SPTBN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6S0 Sptbn1 "Protein Sptbn1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXU1 SPTBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q01082 SPTBN1 "Spectrin beta chain, non-erythrocytic 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
cd10571105 cd10571, PH_beta_spectrin, Beta-spectrin pleckstri 1e-52
cd01253113 cd01253, PH_ARHGAP21-like, ARHGAP21 and related pr 2e-21
cd13295126 cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckst 3e-19
pfam00169101 pfam00169, PH, PH domain 3e-12
smart00233102 smart00233, PH, Pleckstrin homology domain 4e-12
cd13233110 cd13233, PH_ARHGAP9-like, Beta-spectrin pleckstrin 2e-09
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 3e-07
cd1332690 cd13326, PH_CNK_insect-like, Connector enhancer of 8e-06
cd01230127 cd01230, PH1_Tiam1_2, T-lymphoma invasion and meta 4e-05
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 3e-04
cd13267125 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub 6e-04
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 7e-04
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 0.001
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 0.002
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 0.003
>gnl|CDD|241307 cd10571, PH_beta_spectrin, Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
 Score =  168 bits (429), Expect = 1e-52
 Identities = 57/105 (54%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 51  IQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDF-VASKAATSPIIIFKA 109
           ++G LERKHEL+SGGKKA+ RSWK +Y VL GQ L F+KDQ      S A   P+ +  A
Sbjct: 1   MEGFLERKHELESGGKKASNRSWKKVYCVLKGQELSFYKDQKAAASESYAGEPPLNLSGA 60

Query: 110 RCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFH 154
            CE A DY K+KHVFRL  +DGSE+LF A  E  M DWV K+   
Sbjct: 61  VCEVASDYKKKKHVFRLRLSDGSEYLFQAKDEEEMNDWVQKLQAA 105


Beta spectrin binds actin and functions as a major component of the cytoskeleton underlying cellular membranes. Beta spectrin consists of multiple spectrin repeats followed by a PH domain, which binds to inositol-1,4,5-trisphosphate. The PH domain of beta-spectrin is thought to play a role in the association of spectrin with the plasma membrane of cells. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 105

>gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241449 cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241387 cd13233, PH_ARHGAP9-like, Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241264 cd01230, PH1_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2 Pleckstrin Homology (PH) domain, N-terminal domain Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.94
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.94
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.9
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.79
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.75
KOG0932|consensus774 99.73
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.69
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.69
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.69
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.68
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.67
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.67
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.67
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.66
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.65
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.63
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.62
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.6
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.6
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.56
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.51
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.49
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.48
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.44
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.37
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.33
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.26
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.25
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.23
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.07
PF1540989 PH_8: Pleckstrin homology domain 99.07
KOG0930|consensus395 99.01
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.91
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 98.86
KOG4407|consensus 1973 98.81
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.64
KOG0517|consensus2473 98.63
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 98.57
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.45
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.39
KOG0690|consensus 516 98.37
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.36
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 98.27
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 98.25
KOG3640|consensus1116 98.24
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.24
PTZ00267478 NIMA-related protein kinase; Provisional 98.11
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.01
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 97.95
KOG2059|consensus800 97.94
KOG1451|consensus 812 97.76
KOG1090|consensus1732 97.68
KOG3751|consensus622 97.59
PTZ00283496 serine/threonine protein kinase; Provisional 97.56
KOG0521|consensus 785 97.54
KOG3531|consensus1036 97.38
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.14
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.08
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 97.04
PLN02866 1068 phospholipase D 96.99
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 96.97
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 96.92
KOG1117|consensus 1186 96.84
KOG3723|consensus851 96.64
cd04388200 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator pr 96.52
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 96.2
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 96.0
PF15408104 PH_7: Pleckstrin homology domain 95.94
KOG1738|consensus638 95.92
KOG3549|consensus505 95.8
KOG1117|consensus 1186 95.71
cd04382193 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase- 95.68
cd04390199 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPas 95.55
cd04383188 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activato 95.5
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 95.27
cd04408200 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator 95.2
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 95.19
cd04372194 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase- 95.18
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 95.05
cd04376206 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-acti 95.03
cd04379207 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator 95.0
PF15406112 PH_6: Pleckstrin homology domain 94.91
cd04409211 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activato 94.9
cd04381182 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activa 94.78
KOG0248|consensus 936 94.57
KOG3523|consensus695 94.35
cd04407186 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPas 94.26
cd04378203 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPas 94.19
cd04396225 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPas 93.99
KOG4424|consensus623 93.83
cd04406186 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPas 93.76
cd04387196 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator pr 93.7
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 93.46
cd04397213 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activato 93.2
KOG3543|consensus 1218 92.94
KOG2070|consensus661 92.92
cd04373185 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator 92.64
cd04403187 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: G 92.37
KOG1739|consensus 611 92.23
PF15411116 PH_10: Pleckstrin homology domain 92.02
cd04385184 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator 91.8
cd04386203 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activa 91.78
cd04391216 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-ac 91.68
cd04374203 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein 91.44
cd04375220 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator 91.29
cd04384195 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activato 91.2
cd04395196 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-ac 91.05
cd04398192 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activato 90.99
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 90.53
cd04380220 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activato 89.65
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 89.13
cd04400190 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activato 88.66
cd04377186 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase- 88.56
cd04392208 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-ac 88.51
cd04389187 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator 88.37
cd04402192 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-ac 88.26
cd04393189 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-ac 87.78
cd04404195 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase- 87.75
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 87.61
cd04394202 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase- 87.27
cd00159169 RhoGAP RhoGAP: GTPase-activator protein (GAP) for 87.22
PF15404185 PH_4: Pleckstrin homology domain 85.57
KOG4269|consensus1112 82.77
KOG1737|consensus 799 82.16
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 81.61
smart00324174 RhoGAP GTPase-activator protein for Rho-like GTPas 81.4
KOG1264|consensus 1267 81.19
PF00620151 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members 81.07
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
Probab=99.94  E-value=3.9e-27  Score=198.59  Aligned_cols=107  Identities=50%  Similarity=0.800  Sum_probs=82.8

Q ss_pred             EEEEEEeeeeeeccCCccc--cccCCceEEEEEeCCeEeEEecCchhhccc----------CCCccEEecccEEEecCCC
Q psy10626         50 EIQGVLERKHELQSGGKKA--AVRSWKSLYTVLCGQLLCFFKDQDDFVASK----------AATSPIIIFKARCEKAGDY  117 (344)
Q Consensus        50 ~KeGwL~RKq~lesgGKKs--~~RsWKkrwfVLrG~~L~fYKDeke~a~~~----------a~~~~IsL~ga~v~ia~dy  117 (344)
                      +|+|||.||++++.+|||.  ..|+|+.+|+||+|+.|+||||+.......          .+...|+|.+|.|+++.||
T Consensus         1 ~keG~l~RK~~~~~~gkk~~~~~R~Wk~~y~vL~g~~L~~~k~~~~~~~~~~~~~~~~~~~~p~~~i~L~~a~a~~a~dY   80 (119)
T PF15410_consen    1 YKEGILMRKHELESGGKKASRSKRSWKQVYAVLQGGQLYFYKDEKSPASSTPPDIQSVENAKPDSSISLHHALAEIASDY   80 (119)
T ss_dssp             --EEEEEEEEEEECTTCC---S---EEEEEEEEETTEEEEESSHHHHCCT-BS---SS--E-----EE-TT-EEEEETTB
T ss_pred             CceEEEEEEEEEcCCCCCcCCCCCCccEEeEEEECCEEEEEccCcccccCCcccccccccCcceeEEEecceEEEeCccc
Confidence            4899999999999999999  799999999999999999999966533221          1234599999999999999


Q ss_pred             CCCcceEEEEeCCCcEEEEECCCHHHHHHHHHHHHHhhC
Q psy10626        118 TKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQ  156 (344)
Q Consensus       118 ~KRKnVFrL~tpdg~eyLFqAeSeeEM~eWI~AIr~aaa  156 (344)
                      +||+|||+|+++||.+|||||.|++||++||.+||.+|+
T Consensus        81 ~Kr~~VFrL~~~dg~e~Lfqa~~~~~m~~Wi~~IN~~AA  119 (119)
T PF15410_consen   81 TKRKNVFRLRTADGSEYLFQASDEEEMNEWIDAINYAAA  119 (119)
T ss_dssp             TTCSSEEEEE-TTS-EEEEE-SSHHHHHHHHHHHHHH--
T ss_pred             ccCCeEEEEEeCCCCEEEEECCCHHHHHHHHHHHhhhcC
Confidence            999999999999999999999999999999999999885



>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase) Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>cd04382 RhoGAP_MgcRacGAP RhoGAP_MgcRacGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in MgcRacGAP proteins Back     alignment and domain information
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain Back     alignment and domain information
>cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd04408 RhoGAP_GMIP RhoGAP_GMIP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd04376 RhoGAP_ARHGAP6 RhoGAP_ARHGAP6: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP6-like proteins Back     alignment and domain information
>cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd04409 RhoGAP_PARG1 RhoGAP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>cd04381 RhoGap_RalBP1 RhoGap_RalBP1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in RalBP1 proteins, also known as RLIP, RLIP76 or cytocentrin Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>cd04407 RhoGAP_myosin_IXB RhoGAP_myosin_IXB: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXB Back     alignment and domain information
>cd04378 RhoGAP_GMIP_PARG1 RhoGAP_GMIP_PARG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of GMIP (Gem interacting protein) and PARG1 (PTPL1-associated RhoGAP1) Back     alignment and domain information
>cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA Back     alignment and domain information
>cd04387 RhoGAP_Bcr RhoGAP_Bcr: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Bcr (breakpoint cluster region protein)-like proteins Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd04397 RhoGAP_fLRG1 RhoGAP_fLRG1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal LRG1-like proteins Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>cd04373 RhoGAP_p190 RhoGAP_p190: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p190-like proteins Back     alignment and domain information
>cd04403 RhoGAP_ARHGAP27_15_12_9 RhoGAP_ARHGAP27_15_12_9: GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP27 (also called CAMGAP1), ARHGAP15, 12 and 9-like proteins; This subgroup of ARHGAPs are multidomain proteins that contain RhoGAP, PH, SH3 and WW domains Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs Back     alignment and domain information
>cd04386 RhoGAP_nadrin RhoGAP_nadrin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of Nadrin-like proteins Back     alignment and domain information
>cd04391 RhoGAP_ARHGAP18 RhoGAP_ARHGAP18: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP18-like proteins Back     alignment and domain information
>cd04374 RhoGAP_Graf RhoGAP_Graf: GTPase-activator protein (GAP) domain for Rho-like GTPases found in GRAF (GTPase regulator associated with focal adhesion kinase); Graf is a multi-domain protein, containing SH3 and PH domains, that binds focal adhesion kinase and influences cytoskeletal changes mediated by Rho proteins Back     alignment and domain information
>cd04375 RhoGAP_DLC1 RhoGAP_DLC1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of DLC1-like proteins Back     alignment and domain information
>cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA Back     alignment and domain information
>cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins Back     alignment and domain information
>cd04398 RhoGAP_fRGD1 RhoGAP_fRGD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD1-like proteins Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd04380 RhoGAP_OCRL1 RhoGAP_OCRL1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in OCRL1-like proteins Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd04400 RhoGAP_fBEM3 RhoGAP_fBEM3: RhoGAP (GTPase-activator [GAP] protein for Rho-like small GTPases) domain of fungal BEM3-like proteins Back     alignment and domain information
>cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins Back     alignment and domain information
>cd04392 RhoGAP_ARHGAP19 RhoGAP_ARHGAP19: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP19-like proteins Back     alignment and domain information
>cd04389 RhoGAP_KIAA1688 RhoGAP_KIAA1688: GTPase-activator protein (GAP) domain for Rho-like GTPases found in KIAA1688-like proteins; KIAA1688 is a protein of unknown function that contains a RhoGAP domain and a myosin tail homology 4 (MyTH4) domain Back     alignment and domain information
>cd04402 RhoGAP_ARHGAP20 RhoGAP_ARHGAP20: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP20-like proteins Back     alignment and domain information
>cd04393 RhoGAP_FAM13A1a RhoGAP_FAM13A1a: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of FAM13A1, isoform a-like proteins Back     alignment and domain information
>cd04404 RhoGAP-p50rhoGAP RhoGAP-p50rhoGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of p50RhoGAP-like proteins; p50RhoGAP, also known as RhoGAP-1, contains a C-terminal RhoGAP domain and an N-terminal Sec14 domain which binds phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd04394 RhoGAP-ARHGAP11A RhoGAP-ARHGAP11A: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP11A-like proteins Back     alignment and domain information
>cd00159 RhoGAP RhoGAP: GTPase-activator protein (GAP) for Rho-like GTPases; GAPs towards Rho/Rac/Cdc42-like small GTPases Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG4269|consensus Back     alignment and domain information
>KOG1737|consensus Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>smart00324 RhoGAP GTPase-activator protein for Rho-like GTPases Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PF00620 RhoGAP: RhoGAP domain; InterPro: IPR000198 Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
1btn_A106 Structure Of The Binding Site For Inositol Phosphat 9e-16
1wjm_A123 Solution Structure Of Pleckstrin Homology Domain Of 3e-15
1dro_A122 Nmr Structure Of The CytoskeletonSIGNAL TRANSDUCTIO 5e-12
2j59_M168 Crystal Structure Of The Arf1:arhgap21-Arfbd Comple 4e-06
2dhj_A125 Solution Structure Of The Ph Domain Of Rho Gtpase A 1e-05
3pp2_A124 Crystal Structure Of The Pleckstrin Homology Domain 1e-04
>pdb|1BTN|A Chain A, Structure Of The Binding Site For Inositol Phosphates In A Ph Domain Length = 106 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 9e-16, Method: Composition-based stats. Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 2/104 (1%) Query: 51 IQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAATS--PIIIFK 108 ++G L RKHE ++ KKA+ RSW ++Y V+ Q + F+KD + S P+ + + Sbjct: 1 MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKE 60 Query: 109 ARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKIS 152 A CE A DY K+KHVF+L +DG+E+LF A + M W+ IS Sbjct: 61 AICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAIS 104
>pdb|1WJM|A Chain A, Solution Structure Of Pleckstrin Homology Domain Of Human Beta Iii Spectrin Length = 123 Back     alignment and structure
>pdb|1DRO|A Chain A, Nmr Structure Of The CytoskeletonSIGNAL TRANSDUCTION Protein Length = 122 Back     alignment and structure
>pdb|2J59|M Chain M, Crystal Structure Of The Arf1:arhgap21-Arfbd Complex Length = 168 Back     alignment and structure
>pdb|2DHJ|A Chain A, Solution Structure Of The Ph Domain Of Rho Gtpase Activating Protein 21 From Human Length = 125 Back     alignment and structure
>pdb|3PP2|A Chain A, Crystal Structure Of The Pleckstrin Homology Domain Of Arhgap27 Length = 124 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 2e-38
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 1e-37
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 2e-33
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 6e-33
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 2e-31
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 9e-28
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 9e-25
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 4e-23
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 3e-20
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 3e-15
3cxb_B112 Pleckstrin homology domain-containing family M mem 5e-15
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 4e-12
2d9y_A117 Pleckstrin homology domain-containing protein fami 7e-12
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 2e-11
2yry_A122 Pleckstrin homology domain-containing family A mem 2e-11
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 4e-11
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 5e-11
2dkp_A128 Pleckstrin homology domain-containing family A mem 6e-11
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 7e-11
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 2e-09
1u5e_A211 SRC-associated adaptor protein; novel dimerization 4e-09
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 7e-09
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 9e-09
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 9e-08
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-07
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 3e-07
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 5e-07
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 6e-07
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 1e-06
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 2e-06
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 2e-06
3aj4_A112 Pleckstrin homology domain-containing family B ME; 5e-06
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 6e-06
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 6e-06
3rcp_A103 Pleckstrin homology domain-containing family A ME; 1e-05
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 1e-05
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 1e-05
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 1e-05
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 3e-05
1v5p_A126 Pleckstrin homology domain-containing, family A; T 4e-05
1v88_A130 Oxysterol binding protein-related protein 8; vesic 7e-05
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 9e-05
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-04
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 1e-04
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 1e-04
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 1e-04
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 2e-04
2d9v_A130 Pleckstrin homology domain-containing protein fami 2e-04
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 5e-04
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 5e-04
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 7e-04
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
 Score =  132 bits (333), Expect = 2e-38
 Identities = 44/116 (37%), Positives = 64/116 (55%), Gaps = 2/116 (1%)

Query: 47  PPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKA--ATSPI 104
              +++G+L RK E+++ GKKAA RSW+++Y VL    L F+KD     A        P+
Sbjct: 6   SGEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPV 65

Query: 105 IIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQLPPS 160
            + +A+   A DY KRKHVF+L   DG E+LF A  E  M  W+  ++      PS
Sbjct: 66  SLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIASGPS 121


>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 136 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.94
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.93
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.92
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.91
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.9
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.9
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.87
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.85
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.85
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.81
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.81
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.79
2yry_A122 Pleckstrin homology domain-containing family A mem 99.79
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.79
1wi1_A126 Calcium-dependent activator protein for secretion, 99.79
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.79
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.78
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.78
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.78
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.78
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.77
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.77
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.77
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.77
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.77
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.76
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.75
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.75
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.75
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.75
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.75
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.74
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.74
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.73
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.73
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.72
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.72
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.72
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.72
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.71
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.7
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.7
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.7
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.7
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.69
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.68
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.68
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.68
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.68
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.67
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.67
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.61
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.59
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.58
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.58
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.57
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.57
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.52
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.47
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.43
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.41
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.39
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.3
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.25
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.17
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.14
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.13
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.1
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 98.63
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.51
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.49
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.48
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 98.48
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.86
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 97.53
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.44
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.26
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.17
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.09
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.07
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 96.98
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.95
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 96.92
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 96.91
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.88
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 96.83
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 96.7
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 96.69
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 96.69
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 96.57
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 96.48
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.37
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 96.21
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 96.04
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 95.97
2ovj_A201 Mgcracgap, RAC GTPase-activating protein 1; signal 95.63
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 95.52
1f7c_A231 Rhogap protein; GTPase activating protein, RHO GTP 95.28
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 95.24
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 95.05
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 94.93
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 94.31
1pbw_A216 Rhogap domain, phosphatidylinositol 3-kinase; phos 93.7
1tx4_A198 P50-rhogap; complex (GTPase activation/proto-oncog 93.51
2osa_A202 N-chimaerin; RHO-GAP, GTPase activation, structura 93.27
3kuq_A228 RHO GTPase-activating protein 7; structural genomi 92.82
2ee4_A209 RHO GTPase activating protein 5 variant; all alpha 92.64
1ow3_A242 RHO-GTPase-activating protein 1; complex, GTPase, 92.5
3byi_A214 RHO GTPase activating protein 15; BM046, arhgap15, 92.4
3iug_A229 RHO/CDC42/RAC GTPase-activating protein RICS; stru 92.07
3fk2_A246 Glucocorticoid receptor DNA-binding factor 1; stru 91.93
3msx_B201 RHO GTPase-activating protein 20; protein-proten c 91.82
1foe_A377 T-lymphoma invasion and metastasis inducing protei 91.34
2xs6_A214 Phosphatidylinositol 3-kinase regulatory subunit; 90.77
3qis_A366 Inositol polyphosphate 5-phosphatase OCRL-1; DENT 88.6
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 88.02
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 83.12
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
Probab=99.94  E-value=1e-26  Score=193.67  Aligned_cols=109  Identities=31%  Similarity=0.485  Sum_probs=94.4

Q ss_pred             CCeEEEEEEeeeeeeccCCccccccCCceEEEEEeCCeEeEEecCchhhccc--------CCCccEEecccEEEecC-CC
Q psy10626         47 PPVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASK--------AATSPIIIFKARCEKAG-DY  117 (344)
Q Consensus        47 ~~V~KeGwL~RKq~lesgGKKs~~RsWKkrwfVLrG~~L~fYKDeke~a~~~--------a~~~~IsL~ga~v~ia~-dy  117 (344)
                      +.|.|+|||.||++++. |||...++|+++||||+|+.|+||||+.+.....        .+...|+|.+|.|+++. ++
T Consensus         6 ~~v~keG~L~rK~~~~~-gkk~~~r~W~~~w~VL~~~~L~~yKd~~~~~~~~~~~~~~~~~~~~~i~L~~a~v~~~~~d~   84 (124)
T 3pp2_A            6 KTLDKAGVLHRTKTADK-GKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDK   84 (124)
T ss_dssp             ---CEEEEEEEEEEEET-TEECSSCCCEEEEEEEETTEEEEESCSBCC---CBCCGGGGCSEEEEEECTTCEEEECCGGG
T ss_pred             CcEEEEEEEEEEEeccC-CccCCCCCceEEEEEEECCEEEEEecCccccccCccCcccccCCcceEEcCCCEEEeccccc
Confidence            46999999999998876 9998889999999999999999999988653211        24678999999999986 89


Q ss_pred             CCCcceEEEEeCCCcEEEEECCCHHHHHHHHHHHHHhhC
Q psy10626        118 TKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQ  156 (344)
Q Consensus       118 ~KRKnVFrL~tpdg~eyLFqAeSeeEM~eWI~AIr~aaa  156 (344)
                      .+|+|||+|++++|.+|+|||+|++||++||.+|+.|+.
T Consensus        85 ~krk~vF~l~t~~~~~ylfqA~s~~e~~~Wi~aI~~aI~  123 (124)
T 3pp2_A           85 SSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQ  123 (124)
T ss_dssp             CSSSSEEEEECTTSCEEEEECSCHHHHHHHHHHHHHHHC
T ss_pred             CCCceEEEEECCCCCEEEEECCCHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999998864



>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2ovj_A Mgcracgap, RAC GTPase-activating protein 1; signaling protein, structural genomics, structural genomics consortium, SGC; HET: 7PE; 1.49A {Homo sapiens} Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1f7c_A Rhogap protein; GTPase activating protein, RHO GTPase regulator, BH domain, signaling protein; 2.40A {Gallus gallus} SCOP: a.116.1.1 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1pbw_A Rhogap domain, phosphatidylinositol 3-kinase; phosphotransferase, tpase activating protein, CDC42, phosphoinositide 3-kinase, SH3 domain; 2.00A {Homo sapiens} SCOP: a.116.1.1 Back     alignment and structure
>1tx4_A P50-rhogap; complex (GTPase activation/proto-oncogene), GTPase, transition state, GAP; HET: GDP; 1.65A {Homo sapiens} SCOP: a.116.1.1 PDB: 1am4_A* 1grn_B* Back     alignment and structure
>2osa_A N-chimaerin; RHO-GAP, GTPase activation, structural genomics, structural genomics consortium, SGC, signaling protein; 1.80A {Homo sapiens} Back     alignment and structure
>3kuq_A RHO GTPase-activating protein 7; structural genomics consortium, GTPase activation, SGC, alternative splicing, cytoplasm, phosphoprotein; 2.30A {Homo sapiens} Back     alignment and structure
>2ee4_A RHO GTPase activating protein 5 variant; all alpha protein, GTPase-activating protein for RHO family members, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2ee5_A Back     alignment and structure
>1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} SCOP: a.116.1.1 PDB: 1rgp_A 2ngr_B* Back     alignment and structure
>3byi_A RHO GTPase activating protein 15; BM046, arhgap15, structural genomics consortium, signaling protein; 2.25A {Homo sapiens} Back     alignment and structure
>3iug_A RHO/CDC42/RAC GTPase-activating protein RICS; structural genomics consortium (SGC), GAP, alternative splicing, cell junction, cell membrane; 1.77A {Homo sapiens} Back     alignment and structure
>3fk2_A Glucocorticoid receptor DNA-binding factor 1; structural genomics consortium, GTPase-activating protein, SGC, alternative splicing, anti-oncogene; 2.80A {Homo sapiens} Back     alignment and structure
>3msx_B RHO GTPase-activating protein 20; protein-proten complex, transition state, protein BI; HET: GDP; 1.65A {Homo sapiens} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2xs6_A Phosphatidylinositol 3-kinase regulatory subunit; structural genomics consortium, SGC, transferase; 2.09A {Homo sapiens} Back     alignment and structure
>3qis_A Inositol polyphosphate 5-phosphatase OCRL-1; DENT disease, RAC1, RAB gtpases, APPL1, endocytic PATH golgi complex, hydrolase-protein binding complex; 2.30A {Homo sapiens} PDB: 2qv2_A Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 344
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 1e-22
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 1e-20
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 1e-19
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 6e-19
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 2e-16
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 9e-10
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 1e-09
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 2e-09
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 1e-08
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 2e-08
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 3e-07
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 5e-07
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 6e-07
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 2e-06
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 1e-05
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 1e-05
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 4e-05
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 9e-05
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 9e-05
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 1e-04
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 8e-04
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: beta-spectrin
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score = 89.6 bits (221), Expect = 1e-22
 Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 48  PVEIQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVASKAAT----SP 103
               +G + RKHE  S  KKA+ RSW  +Y       + F+KDQ  + ++   T      
Sbjct: 7   GEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGEPS 66

Query: 104 IIIFKARCEKAGDYTKRKHVFRLYCTDGSEFLFLAPSETLMEDWVNKISFHAQ 156
             +  A  E A DYTK+KHV R+   +G+ FL  A  +T M  WV  +   + 
Sbjct: 67  YDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSD 119


>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.88
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.87
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.86
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.85
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.8
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.79
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.78
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.78
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.78
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.76
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.75
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.75
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.73
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.73
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.72
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.71
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.69
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.68
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.67
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.67
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.66
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.66
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.65
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.64
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.64
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.62
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.51
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.94
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.65
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.42
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.21
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.81
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 97.7
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.48
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.46
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.03
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.84
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 96.64
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 96.43
d1pbwa_184 p85 alpha subunit RhoGAP domain {Human (Homo sapie 95.81
d1f7ca_191 Graf {Chicken (Gallus gallus) [TaxId: 9031]} 94.22
d1xa6a1196 Beta-chimaerin, C-terminal domain {Human (Homo sap 93.39
d1tx4a_196 p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 96 89.47
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: beta-spectrin
species: Mouse (Mus musculus), brain [TaxId: 10090]
Probab=99.88  E-value=3.3e-22  Score=156.13  Aligned_cols=104  Identities=39%  Similarity=0.704  Sum_probs=93.0

Q ss_pred             EEEEEeeeeeeccCCccccccCCceEEEEEeCCeEeEEecCchhhcc--cCCCccEEecccEEEecCCCCCCcceEEEEe
Q psy10626         51 IQGVLERKHELQSGGKKAAVRSWKSLYTVLCGQLLCFFKDQDDFVAS--KAATSPIIIFKARCEKAGDYTKRKHVFRLYC  128 (344)
Q Consensus        51 KeGwL~RKq~lesgGKKs~~RsWKkrwfVLrG~~L~fYKDeke~a~~--~a~~~~IsL~ga~v~ia~dy~KRKnVFrL~t  128 (344)
                      +||||.||++....+|+...++|+++||||+++.|+||+++.+....  ......|+|.+|.+..+.++.+++|+|.|.+
T Consensus         1 ~eG~L~rk~~~~~~~kk~~~~~Wk~r~~vL~~~~L~~yk~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~~~f~i~~   80 (106)
T d1btna_           1 MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRL   80 (106)
T ss_dssp             CEEEEEEEEEECSTTCBCSCCCCEEEEEEEETTEEEEESSHHHHHHTCCSSSCCCEECTTCEEEECSSCCSSSSEEEEEC
T ss_pred             CeeeEEEeeEccCCCcccCCCCCcEEEEEEECCEEEEEeChhhcccccccCcceeEEeccceeeeccccccCcceEeecc
Confidence            58999999999999999989999999999999999999998764432  2345679999999888888889999999999


Q ss_pred             CCCcEEEEECCCHHHHHHHHHHHHHh
Q psy10626        129 TDGSEFLFLAPSETLMEDWVNKISFH  154 (344)
Q Consensus       129 pdg~eyLFqAeSeeEM~eWI~AIr~a  154 (344)
                      .++.+|+|+|+|++||++||.+|+.|
T Consensus        81 ~~~~~~~~~a~s~~e~~~W~~ai~~A  106 (106)
T d1btna_          81 SDGNEYLFQAKDDEEMNTWIQAISSA  106 (106)
T ss_dssp             TTSCEEEEECSSHHHHHHHHHHHHHC
T ss_pred             cCCCEEEEECCCHHHHHHHHHHHHhC
Confidence            99999999999999999999999865



>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbwa_ a.116.1.1 (A:) p85 alpha subunit RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f7ca_ a.116.1.1 (A:) Graf {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xa6a1 a.116.1.1 (A:271-466) Beta-chimaerin, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure