Diaphorina citri psyllid: psy10639


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MFNSPNWRHPARFRLDQKCQQEFHDRGPEDIHRPIYPYQESDRFLLDPIRYKTELCRSLEGYRPCQYGERCRFAHSVEELRPPVRHYRYRTRLCRNYHHNGVCNYGTRCSFIHRVPGEEVDPVKKYREIHGDIQETRDIPGAATRGDRSRIQSGSSCSSSWSSASNASYSPGWSTASSKTFEFPHRAFF
ccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
************************************************IRYKTELCRSLEGYRPCQYGERCRFAHSVEELRPPVRHYRYRTRLCRNYHHNGVCNYGTRCSFIHRVP*******************************************************************P*RA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNSPNWRHPARFRLDQKCQQEFHDRGPEDIHRPIYPYQESDRFLLDPIRYKTELCRSLEGYRPCQYGERCRFAHSVEELRPPVRHYRYRTRLCRNYHHNGVCNYGTRCSFIHRVPGEEVDPVKKYREIHGDIQETRDIPGAATRGDRSRIQSGSSCSSSWSSASNASYSPGWSTASSKTFEFPHRAFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0006402 [BP]mRNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0019439

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 46-84
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 6-34,46
View the alignment between query and template
View the model in PyMOL