Diaphorina citri psyllid: psy10640


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MTGAFPSIWRQRQGIRQFTTSSSLSEAEKSQQHTITQRETIRTALAMGADRGIHVEVSGPEYETLQPFHISKILAKVAQEEKVDMVIVGKQKAKKKPIKKVSPKDMGVDTGAHIEIVTVEDPPVRQAGSIVPDVDTLAIDDDSNQTAQMTAAFLNWPQATFASKVDKTDGELTVKREIDGGLETIKVKLPAVISADLRLNEPRYATLPNIMKSQVFCGQILNQMKVKPPSSVMEQLQLGKYY
ccccccHHHHHccccEEEEEEEEcccccccccccccHHHHHHHHHHccccEEEEEECcccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccCEEEEccccccccccccccccccccccccccccHHHHHHHHccccEEEEEEEEEEEccEEEEEEEccccEEEEEEcccEEEEECcccccccccccHHHHHHccccccECccccccccccccccccccccc
***AFPSIWRQRQGIRQFTTSSSLSEAEKSQQHTITQRETIRTALAMGADRGIHVEVSGPEYETLQPFHISKILAKVAQEEKVDMVIVGKQKAKKKPIKKVSPKDMGVDTGAHIEIVTVEDPPVRQAGSIVPDVDTLAIDDDSNQTAQMTAAFLNWPQATFASKVDKTDGELTVKREIDGGLETIKVKLPAVISADLRLNEPRYATLPNIMKSQVFCGQILNQMKVKPPSSVMEQLQL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGAFPSIWRQRQGIRQFTTSSSLSEAEKSQQHTITQRETIRTALAMGADRGIHVEVSGPEYETLQPFHISKILAKVAQEEKVDMVIVGKQKAKKKPIKKVSPKDMGVDTGAHIEIVTVEDPPVRQAGSIVPDVDTLAIDDDSNQTAQMTAAFLNWPQATFASKVDKTDGELTVKREIDGGLETIKVKLPAVISADLRLNEPRYATLPNIMKSQVFCGQILNQMKVKPPSSVMEQLQLGKYY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Electron transfer flavoprotein subunit beta The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).confidentQ68FU3
Electron transfer flavoprotein subunit beta The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).confidentQ6UAQ8
Electron transfer flavoprotein subunit beta The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).confidentQ2TBV3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EFV, chain B
Confidence level:very confident
Coverage over the Query: 29-91,138-209
View the alignment between query and template
View the model in PyMOL
Template: 1EFV, chain B
Confidence level:very confident
Coverage over the Query: 2-133
View the alignment between query and template
View the model in PyMOL