Diaphorina citri psyllid: psy10666


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MNRAEMSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQVSADM
ccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccCEccEEECcccccccccccHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
********DEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRAEMSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQVSADM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine hydroxymethyltransferase, mitochondrial Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Interconversion of serine and glycine. Associates with mitochondrial DNA.confidentP34897
Serine hydroxymethyltransferase, mitochondrial Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Interconversion of serine and glycine. Associates with mitochondrial DNA.confidentQ3SZ20

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OU5, chain A
Confidence level:very confident
Coverage over the Query: 15-63,76-151,162-182
View the alignment between query and template
View the model in PyMOL