Psyllid ID: psy10666

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MNRAEMSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQVSADM
ccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccEEccEEEEcccccccccccHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHcccEcccccHHHHHHHHHHHHEEEEccEEEEEEccccccccccEcHHHHHHHHHHHcccEEEEEcccccHEEcHHHHHccccccHHHHHHHHHHcccEEEEEHHHHHHHHHccccccccccccEEEcccccccccccccHHHHHHcccccccccEccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccEccccc
mnraemssdeegkyyggnqfIDEIEIVAQQRSLKafnldpeqwgcnvqpysgspanfaVYTGLkisatsiffeslpykvntetglidYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREirdlynepdvvgeiksgrlRWAGHVqrreedsnirsiwehqpegrrprgrpknrwkdqVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGlrqvsadm
mnraemssdeegkyyggNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEetskwrikhnreirdlynepdvvgeiksgrlrwaghvqrreedsnirsiwehqpegrrprgrpknrwkdqvrkdmtilnlttedsfnraLWRQKVGEAKYLLGNylllkmsglrqvsadm
MNRAEMSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDlklltkvlleetSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQVSADM
*************YYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHV***********************************KDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSG********
********DEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQ*****
***********GKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAG*********NIRSIWEHQ***************DQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQVSADM
*****MSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSG********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRAEMSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGLKISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVVGEIKSGRLRWAGHVQRREEDSNIRSIWEHQPEGRRPRGRPKNRWKDQVRKDMTILNLTTEDSFNRALWRQKVGEAKYLLGNYLLLKMSGLRQVSADM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
P35623 484 Serine hydroxymethyltrans N/A N/A 0.395 0.196 0.565 1e-33
Q3SZ20 504 Serine hydroxymethyltrans yes N/A 0.462 0.220 0.514 1e-33
P34897 504 Serine hydroxymethyltrans yes N/A 0.462 0.220 0.507 5e-33
P34896 483 Serine hydroxymethyltrans no N/A 0.395 0.196 0.557 9e-33
Q5RFK5 483 Serine hydroxymethyltrans no N/A 0.395 0.196 0.557 1e-32
P14519 504 Serine hydroxymethyltrans yes N/A 0.462 0.220 0.492 1e-32
Q5E9P9 484 Serine hydroxymethyltrans no N/A 0.395 0.196 0.549 3e-32
P50431 478 Serine hydroxymethyltrans no N/A 0.395 0.198 0.549 5e-32
P07511 484 Serine hydroxymethyltrans no N/A 0.395 0.196 0.549 1e-31
P50432 507 Serine hydroxymethyltrans yes N/A 0.387 0.183 0.516 1e-29
>sp|P35623|GLYC_SHEEP Serine hydroxymethyltransferase, cytosolic OS=Ovis aries GN=SHMT1 PE=1 SV=3 Back     alignment and function desciption
 Score =  142 bits (359), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 83/122 (68%), Gaps = 27/122 (22%)

Query: 13  KYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL--------- 63
           +YYGG +FIDE+E++ Q+R+L+ + LDPE WG NVQPYSGSPANFAVYT L         
Sbjct: 81  RYYGGTEFIDELEVLCQKRALQVYGLDPECWGVNVQPYSGSPANFAVYTALVEPHGRIMG 140

Query: 64  ------------------KISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIA 105
                             KISATSIFFES+PYKVN +TG I+YD+L E+ARLF PRLIIA
Sbjct: 141 LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPRLIIA 200

Query: 106 ET 107
            T
Sbjct: 201 GT 202
Interconversion of serine and glycine.
Ovis aries (taxid: 9940)
EC: 2EC: .EC: 1EC: .EC: 2EC: .EC: 1
>sp|Q3SZ20|GLYM_BOVIN Serine hydroxymethyltransferase, mitochondrial OS=Bos taurus GN=SHMT2 PE=2 SV=1 Back     alignment and function description
>sp|P34897|GLYM_HUMAN Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens GN=SHMT2 PE=1 SV=3 Back     alignment and function description
>sp|P34896|GLYC_HUMAN Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens GN=SHMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFK5|GLYC_PONAB Serine hydroxymethyltransferase, cytosolic OS=Pongo abelii GN=SHMT1 PE=2 SV=1 Back     alignment and function description
>sp|P14519|GLYM_RABIT Serine hydroxymethyltransferase, mitochondrial OS=Oryctolagus cuniculus GN=SHMT2 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9P9|GLYC_BOVIN Serine hydroxymethyltransferase, cytosolic OS=Bos taurus GN=SHMT1 PE=2 SV=3 Back     alignment and function description
>sp|P50431|GLYC_MOUSE Serine hydroxymethyltransferase, cytosolic OS=Mus musculus GN=Shmt1 PE=1 SV=3 Back     alignment and function description
>sp|P07511|GLYC_RABIT Serine hydroxymethyltransferase, cytosolic OS=Oryctolagus cuniculus GN=SHMT1 PE=1 SV=2 Back     alignment and function description
>sp|P50432|GLYC_CAEEL Serine hydroxymethyltransferase OS=Caenorhabditis elegans GN=mel-32 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
383865329 464 PREDICTED: serine hydroxymethyltransfera 0.387 0.200 0.658 2e-38
332030783 527 Serine hydroxymethyltransferase [Acromyr 0.387 0.176 0.625 1e-36
312383428 557 hypothetical protein AND_03451 [Anophele 0.387 0.166 0.633 2e-36
322794373 479 hypothetical protein SINV_09632 [Solenop 0.387 0.194 0.625 2e-36
110760746 464 PREDICTED: serine hydroxymethyltransfera 0.387 0.200 0.616 7e-36
307206360 464 Serine hydroxymethyltransferase [Harpegn 0.387 0.200 0.616 9e-36
307166165 524 Serine hydroxymethyltransferase [Campono 0.387 0.177 0.625 1e-35
380028881 412 PREDICTED: LOW QUALITY PROTEIN: serine h 0.387 0.225 0.608 2e-35
340720933 520 PREDICTED: serine hydroxymethyltransfera 0.387 0.178 0.6 4e-35
350398039 520 PREDICTED: serine hydroxymethyltransfera 0.387 0.178 0.6 6e-35
>gi|383865329|ref|XP_003708127.1| PREDICTED: serine hydroxymethyltransferase, cytosolic-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 91/120 (75%), Gaps = 27/120 (22%)

Query: 13  KYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL--------- 63
           +YYGGNQ+IDEIE++AQ+RSL+AFNL+PE+WGCNVQPYSGSPANFAVYTGL         
Sbjct: 64  RYYGGNQYIDEIELLAQKRSLEAFNLNPEEWGCNVQPYSGSPANFAVYTGLIEPHGRIMG 123

Query: 64  ------------------KISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIA 105
                             K+SATSIFFES+PYKVN ETGLIDYDKLAE ARLFKP++IIA
Sbjct: 124 LDLPDGGHLTHGFFTLNKKVSATSIFFESMPYKVNLETGLIDYDKLAEEARLFKPKIIIA 183

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332030783|gb|EGI70459.1| Serine hydroxymethyltransferase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|312383428|gb|EFR28521.1| hypothetical protein AND_03451 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|322794373|gb|EFZ17477.1| hypothetical protein SINV_09632 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|110760746|ref|XP_395263.3| PREDICTED: serine hydroxymethyltransferase [Apis mellifera] Back     alignment and taxonomy information
>gi|307206360|gb|EFN84412.1| Serine hydroxymethyltransferase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307166165|gb|EFN60414.1| Serine hydroxymethyltransferase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380028881|ref|XP_003698113.1| PREDICTED: LOW QUALITY PROTEIN: serine hydroxymethyltransferase-like [Apis florea] Back     alignment and taxonomy information
>gi|340720933|ref|XP_003398883.1| PREDICTED: serine hydroxymethyltransferase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398039|ref|XP_003485067.1| PREDICTED: serine hydroxymethyltransferase, cytosolic-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
UNIPROTKB|G3V5L0215 SHMT2 "Serine hydroxymethyltra 0.212 0.237 0.686 2.1e-32
FB|FBgn0029823 537 CG3011 [Drosophila melanogaste 0.212 0.094 0.705 6.4e-32
UNIPROTKB|Q3SZ20 504 SHMT2 "Serine hydroxymethyltra 0.212 0.101 0.666 3e-31
RGD|1308582 504 Shmt2 "serine hydroxymethyltra 0.212 0.101 0.666 6.1e-31
UNIPROTKB|F1SL74 504 LOC100626911 "Serine hydroxyme 0.212 0.101 0.666 7.8e-31
UNIPROTKB|P34897 504 SHMT2 "Serine hydroxymethyltra 0.212 0.101 0.686 9.5e-31
UNIPROTKB|E2R4L7 531 SHMT2 "Uncharacterized protein 0.212 0.096 0.666 1.2e-30
UNIPROTKB|P14519 504 SHMT2 "Serine hydroxymethyltra 0.212 0.101 0.666 2e-30
ZFIN|ZDB-GENE-071213-1 492 shmt2 "serine hydroxymethyltra 0.212 0.103 0.627 9.2e-29
UNIPROTKB|Q60V73 511 mel-32 "Serine hydroxymethyltr 0.212 0.099 0.666 3.5e-28
UNIPROTKB|G3V5L0 SHMT2 "Serine hydroxymethyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 2.1e-32, Sum P(2) = 2.1e-32
 Identities = 35/51 (68%), Positives = 44/51 (86%)

Query:    13 KYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL 63
             +YYGG + +DEIE++ Q+R+L+AF+LDP QWG NVQPYSGSPAN AVYT L
Sbjct:    83 RYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTAL 133
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0004372 "glycine hydroxymethyltransferase activity" evidence=IEA
GO:0005743 "mitochondrial inner membrane" evidence=IEA
GO:0005758 "mitochondrial intermembrane space" evidence=IEA
GO:0005759 "mitochondrial matrix" evidence=IEA
GO:0006564 "L-serine biosynthetic process" evidence=IEA
GO:0008284 "positive regulation of cell proliferation" evidence=IEA
GO:0008732 "L-allo-threonine aldolase activity" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA
GO:0019264 "glycine biosynthetic process from serine" evidence=IEA
GO:0042802 "identical protein binding" evidence=IEA
GO:0051289 "protein homotetramerization" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0015630 "microtubule cytoskeleton" evidence=IDA
FB|FBgn0029823 CG3011 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ20 SHMT2 "Serine hydroxymethyltransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308582 Shmt2 "serine hydroxymethyltransferase 2 (mitochondrial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SL74 LOC100626911 "Serine hydroxymethyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P34897 SHMT2 "Serine hydroxymethyltransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4L7 SHMT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P14519 SHMT2 "Serine hydroxymethyltransferase, mitochondrial" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071213-1 shmt2 "serine hydroxymethyltransferase 2 (mitochondrial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q60V73 mel-32 "Serine hydroxymethyltransferase" [Caenorhabditis briggsae (taxid:6238)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34897GLYM_HUMAN2, ., 1, ., 2, ., 10.50720.46250.2202yesN/A
Q3SZ20GLYM_BOVIN2, ., 1, ., 2, ., 10.51440.46250.2202yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.2LOW CONFIDENCE prediction!
4th Layer2.1.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
PTZ00094 452 PTZ00094, PTZ00094, serine hydroxymethyltransferas 7e-51
PLN03226 475 PLN03226, PLN03226, serine hydroxymethyltransferas 2e-50
PLN02271 586 PLN02271, PLN02271, serine hydroxymethyltransferas 2e-40
pfam00464380 pfam00464, SHMT, Serine hydroxymethyltransferase 4e-39
cd00378402 cd00378, SHMT, Serine-glycine hydroxymethyltransfe 3e-35
COG0112 413 COG0112, GlyA, Glycine/serine hydroxymethyltransfe 3e-28
PRK00011 416 PRK00011, glyA, serine hydroxymethyltransferase; R 5e-24
PRK13034 416 PRK13034, PRK13034, serine hydroxymethyltransferas 8e-21
PRK13580 493 PRK13580, PRK13580, serine hydroxymethyltransferas 8e-08
>gnl|CDD|240264 PTZ00094, PTZ00094, serine hydroxymethyltransferase; Provisional Back     alignment and domain information 
 Score =  171 bits (435), Expect = 7e-51
 Identities = 67/122 (54%), Positives = 82/122 (67%), Gaps = 28/122 (22%)

Query: 11  EGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL------- 63
             +YYGGN+ +D+IE + Q+R+L+AF LDPE+WG NVQPYSGSPANFAVYT L       
Sbjct: 68  GNRYYGGNEVVDKIENLCQKRALEAFGLDPEEWGVNVQPYSGSPANFAVYTALLQPHDRI 127

Query: 64  --------------------KISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLI 103
                               K+SATSI+FESLPY+VN E GLIDYDKL E A+ F+P+LI
Sbjct: 128 MGLDLPSGGHLTHGFYTAKKKVSATSIYFESLPYQVN-EKGLIDYDKLEELAKAFRPKLI 186

Query: 104 IA 105
           IA
Sbjct: 187 IA 188

Length = 452
>gnl|CDD|215639 PLN03226, PLN03226, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215153 PLN02271, PLN02271, serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|189558 pfam00464, SHMT, Serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|99733 cd00378, SHMT, Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>gnl|CDD|223190 COG0112, GlyA, Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234571 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237280 PRK13034, PRK13034, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184161 PRK13580, PRK13580, serine hydroxymethyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 100.0
KOG2467|consensus 477 100.0
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 100.0
PLN02271 586 serine hydroxymethyltransferase 100.0
PRK13580 493 serine hydroxymethyltransferase; Provisional 99.97
PLN03226 475 serine hydroxymethyltransferase; Provisional 99.93
PTZ00094 452 serine hydroxymethyltransferase; Provisional 99.77
PRK13034 416 serine hydroxymethyltransferase; Reviewed 99.56
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.21
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 99.13
PRK12566 954 glycine dehydrogenase; Provisional 98.24
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 97.3
PLN03032374 serine decarboxylase; Provisional 96.85
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 96.83
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 96.83
PRK05367 954 glycine dehydrogenase; Provisional 96.81
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 96.76
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 96.75
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 96.74
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 96.72
PLN02414 993 glycine dehydrogenase (decarboxylating) 96.58
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 96.56
PRK13237 460 tyrosine phenol-lyase; Provisional 96.54
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 96.38
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 96.35
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 96.29
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 96.23
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 96.18
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 95.98
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 95.95
PF06838 403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 95.87
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 95.8
PRK07179407 hypothetical protein; Provisional 95.72
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 95.69
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 95.39
KOG1549|consensus 428 95.34
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 95.17
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 95.16
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 94.88
PRK02769380 histidine decarboxylase; Provisional 94.64
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 94.45
PLN02263470 serine decarboxylase 94.27
cd06454349 KBL_like KBL_like; this family belongs to the pyri 94.13
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 94.07
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 93.99
KOG2040|consensus 1001 93.73
PRK02948 381 cysteine desulfurase; Provisional 93.64
PLN02651364 cysteine desulfurase 93.64
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 93.33
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 93.19
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 93.14
PRK13520371 L-tyrosine decarboxylase; Provisional 93.1
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 92.96
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 92.92
COG4100 416 Cystathionine beta-lyase family protein involved i 92.65
PLN02409 401 serine--glyoxylate aminotransaminase 92.44
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 92.44
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 92.29
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 92.28
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 91.62
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 91.53
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 91.26
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 91.24
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 91.21
PRK04366 481 glycine dehydrogenase subunit 2; Validated 91.13
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 91.06
PLN02721353 threonine aldolase 90.9
PRK08574 385 cystathionine gamma-synthase; Provisional 90.9
cd00609350 AAT_like Aspartate aminotransferase family. This f 90.67
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 90.52
PRK09082386 methionine aminotransferase; Validated 90.37
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 90.26
PRK12414384 putative aminotransferase; Provisional 89.93
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 89.67
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 89.62
PF0217813 AT_hook: AT hook motif; InterPro: IPR017956 AT hoo 89.33
PLN02880 490 tyrosine decarboxylase 89.24
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 89.01
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 88.94
PLN02242 418 methionine gamma-lyase 88.91
PRK07309391 aromatic amino acid aminotransferase; Validated 88.81
PRK08361391 aspartate aminotransferase; Provisional 88.78
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 88.6
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 88.58
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 88.47
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 88.44
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 88.42
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 88.16
PRK14012 404 cysteine desulfurase; Provisional 87.67
PRK10874 401 cysteine sulfinate desulfinase; Provisional 87.65
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 87.63
PRK08776 405 cystathionine gamma-synthase; Provisional 87.32
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 87.09
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 87.07
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 86.98
PRK07777387 aminotransferase; Validated 86.95
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 86.94
PRK07503 403 methionine gamma-lyase; Provisional 86.66
PLN02590 539 probable tyrosine decarboxylase 86.65
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 86.58
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 86.37
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 85.84
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 85.74
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 85.69
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 85.57
PRK09064407 5-aminolevulinate synthase; Validated 85.47
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 85.46
PRK05968 389 hypothetical protein; Provisional 85.4
PRK07811 388 cystathionine gamma-synthase; Provisional 85.22
PRK10534333 L-threonine aldolase; Provisional 85.13
PRK07550386 hypothetical protein; Provisional 84.93
PRK06767 386 methionine gamma-lyase; Provisional 84.69
PLN00175413 aminotransferase family protein; Provisional 84.62
smart0038426 AT_hook DNA binding domain with preference for A/T 84.47
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 84.23
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 84.03
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 83.96
PRK08912387 hypothetical protein; Provisional 83.65
PRK13578 720 ornithine decarboxylase; Provisional 83.61
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 82.76
TIGR01440172 conserved hypothetical protein TIGR01440. Members 82.48
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 82.42
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 82.38
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 82.21
PRK08363398 alanine aminotransferase; Validated 81.59
PRK07050 394 cystathionine beta-lyase; Provisional 81.5
PRK08249 398 cystathionine gamma-synthase; Provisional 81.04
PRK06836394 aspartate aminotransferase; Provisional 80.73
PRK13393406 5-aminolevulinate synthase; Provisional 80.43
PRK13690184 hypothetical protein; Provisional 80.28
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-45  Score=338.96  Aligned_cols=174  Identities=30%  Similarity=0.427  Sum_probs=151.3

Q ss_pred             cCCCCCCcccCCcccHHHHHHHHHHHHHhhcCCCCCCcccccccCCChhHHHHHHHhh----------------------
Q psy10666          6 MSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL----------------------   63 (240)
Q Consensus         6 ~~g~pg~ryy~G~~~id~iE~la~~r~~~lF~a~~~~w~~nvqp~SG~~An~av~~al----------------------   63 (240)
                      ++||||+||||||+|+|++|+||++|||+||+|+|    |||||||||+||+|||+||                      
T Consensus        55 AEGyPgkRyYgGce~VD~vE~laierak~LFga~~----anVQPhSGs~AN~av~~All~pGDtimgm~l~~GGHltHg~  130 (413)
T COG0112          55 AEGYPGKRYYGGCEYVDEVEELAIERAKKLFGAEY----ANVQPHSGSQANQAVYLALLQPGDTIMGLDLSHGGHLTHGS  130 (413)
T ss_pred             ccCCCCccccCCCeeHHHHHHHHHHHHHHHhCCCc----cccCCCCchHHHHHHHHHHcCCCCeEecccCCCCCcccCCC
Confidence            57999999999999999999999999999999999    8999999999999999999                      


Q ss_pred             ccCcccccceeeeccccCCCcccChHHHHHHHHhhCCCEEEEecccccchhhhhhhhhhhHHHHHhhHHHHhhhCCCchh
Q psy10666         64 KISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYNEPDVV  143 (240)
Q Consensus        64 ~~s~~g~~~~~~~y~~d~~~~~ID~d~~~~~a~~~kPkLIi~G~S~y~r~~d~~~l~E~~~w~~~~N~eIr~~~d~s~Il  143 (240)
                      ++|++|++|++++||||++|+.||||+++++|+++||||||+|+|+|+|++|+++++|     ++...+....+|++||.
T Consensus       131 ~v~~sG~~~~~v~Y~vd~et~~IDyD~~~k~a~e~kPK~ii~G~SaY~r~id~~~~re-----Iad~VGA~L~~DmAHia  205 (413)
T COG0112         131 PVNFSGKLFNVVSYGVDPETGLIDYDEVEKLAKEVKPKLIIAGGSAYSRPIDFKRFRE-----IADEVGAYLMVDMAHVA  205 (413)
T ss_pred             CCCccceeEEeEecccccccCccCHHHHHHHHHHhCCCEEEECccccccccCHHHHHH-----HHHHhCceEEehHHHHH
Confidence            4667789999999999999999999999999999999999999999999999999999     88899999999999999


Q ss_pred             hhhhccceeeeccccccCCCchhhhhhh-hcCCCCCCCCCCCCccHHHHHHhch
Q psy10666        144 GEIKSGRLRWAGHVQRREEDSNIRSIWE-HQPEGRRPRGRPKNRWKDQVRKDMT  196 (240)
Q Consensus       144 ~~I~~rrl~WaGHV~R~~~~~~~k~v~~-~~~~gkR~rGRPrkrW~D~ik~d~~  196 (240)
                      ++|.++...        +|-+....|++ ...+-+.|||.--....+.+.+.+.
T Consensus       206 GLVA~G~~p--------~P~~~AdvVTtTTHKTlrGPrGG~Il~~~eel~kkin  251 (413)
T COG0112         206 GLIAGGVHP--------NPLPHADVVTTTTHKTLRGPRGGIILTNDEELAKKIN  251 (413)
T ss_pred             HHHhcccCC--------CCCCccceEeCCcccCCCCCCceEEEeccHHHHHHhh
Confidence            999887432        22222333443 3468889999966666555555454

>KOG2467|consensus Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PF02178 AT_hook: AT hook motif; InterPro: IPR017956 AT hooks are DNA-binding motifs with a preference for A/T rich regions Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>smart00384 AT_hook DNA binding domain with preference for A/T rich regions Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>TIGR01440 conserved hypothetical protein TIGR01440 Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK13690 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
3ou5_A 490 Human Mitochondrial Serine Hydroxymethyltransferase 4e-34
1bj4_A 470 Recombinant Serine Hydroxymethyltransferase (human) 9e-34
1ls3_B 483 Crystal Structure Of The Complex Between Rabbit Cyt 2e-32
1rv3_A 483 E75l Mutant Of Rabbit Cytosolic Serine Hydroxymethy 2e-32
1rvu_A 483 E75q Mutant Of Rabbit Cytosolic Serine Hydroxymethy 2e-32
1cj0_A 470 Crystal Structure Of Rabbit Cytosolic Serine Hydrox 2e-32
1eji_A 478 Recombinant Serine Hydroxymethyltransferase (Mouse) 4e-32
2vmv_A 405 Crystal Structure Of F351gbsshmt Internal Aldimine 3e-11
2vi8_A 405 Crystal Structure Of S172absshmt Internal Aldimine 3e-11
2vmn_A 405 Crystal Structure Of N341absshmt Internal Aldimine 3e-11
1yjs_A 419 K226q Mutant Of Serine Hydroxymethyltransferase Fro 3e-11
1yjy_A 419 K226m Mutant Of Serine Hydroxymethyltransferase Fro 3e-11
1kkj_A 419 Crystal Structure Of Serine Hydroxymethyltransferas 3e-11
2vgs_A 407 Crystal Structure Of E53qbsshmt Internal Aldimine L 3e-11
2w7d_A 405 Crystal Structure Of Y51fbsshmt Internal Aldimine L 3e-11
3n0l_A 417 Crystal Structure Of Serine Hydroxymethyltransferas 2e-10
3gbx_A 420 Serine Hydroxymethyltransferase From Salmonella Typ 2e-10
3ecd_A 425 Crystal Structure Of Serine Hydroxymethyltransferas 2e-10
2vmr_A 405 Crystal Structure Of Y60absshmt Internal Aldimine L 3e-10
2w7i_A 405 Crystal Structure Of Y61absshmt Internal Aldimine L 3e-10
1dfo_A 417 Crystal Structure At 2.4 Angstrom Resolution Of E. 5e-10
3g8m_A 417 Serine Hydroxymethyltransferase Y55f Mutant Length 5e-10
1eqb_A 417 X-Ray Crystal Structure At 2.7 Angstroms Resolution 1e-09
3pgy_A 415 Serine Hydroxymethyltransferase From Staphylococcus 1e-07
2dkj_A 407 Crystal Structure Of T.Th.Hb8 Serine Hydroxymethylt 3e-07
3h7f_A 447 Crystal Structure Of Serine Hydroxymethyltransferas 4e-07
>pdb|3OU5|A Chain A, Human Mitochondrial Serine Hydroxymethyltransferase 2 Length = 490 Back     alignment and structure 
Iteration: 1

 Score =  140 bits (354), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 85/122 (69%), Gaps = 27/122 (22%)
Query: 13  KYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL--------- 63
           +YYGG + +DEIE++ Q+R+L+AF+LDP QWG NVQPYSGSPAN AVYT L         
Sbjct: 90  RYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMG 149
Query: 64  ------------------KISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIA 105
                             +ISATSIFFES+PYK+N +TGLIDY++LA +ARLF+PRLIIA
Sbjct: 150 LDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIA 209
Query: 106 ET 107
            T
Sbjct: 210 GT 211
>pdb|1BJ4|A Chain A, Recombinant Serine Hydroxymethyltransferase (human) Length = 470 Back     alignment and structure
>pdb|1LS3|B Chain B, Crystal Structure Of The Complex Between Rabbit Cytosolic Serine Hydroxymethyltransferase And Triglu-5-Formyl-Tetrahydrofolate Length = 483 Back     alignment and structure
>pdb|1RV3|A Chain A, E75l Mutant Of Rabbit Cytosolic Serine Hydroxymethyltransferase, Complex With Glycine Length = 483 Back     alignment and structure
>pdb|1RVU|A Chain A, E75q Mutant Of Rabbit Cytosolic Serine Hydroxymethyltransferase Length = 483 Back     alignment and structure
>pdb|1CJ0|A Chain A, Crystal Structure Of Rabbit Cytosolic Serine Hydroxymethyltransferase At 2.8 Angstrom Resolution Length = 470 Back     alignment and structure
>pdb|1EJI|A Chain A, Recombinant Serine Hydroxymethyltransferase (Mouse) Length = 478 Back     alignment and structure
>pdb|2VMV|A Chain A, Crystal Structure Of F351gbsshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2VI8|A Chain A, Crystal Structure Of S172absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2VMN|A Chain A, Crystal Structure Of N341absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|1YJS|A Chain A, K226q Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Glycine Length = 419 Back     alignment and structure
>pdb|1YJY|A Chain A, K226m Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Serine Length = 419 Back     alignment and structure
>pdb|1KKJ|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From B.Stearothermophilus Length = 419 Back     alignment and structure
>pdb|2VGS|A Chain A, Crystal Structure Of E53qbsshmt Internal Aldimine Length = 407 Back     alignment and structure
>pdb|2W7D|A Chain A, Crystal Structure Of Y51fbsshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|3N0L|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Campylobacter Jejuni Length = 417 Back     alignment and structure
>pdb|3GBX|A Chain A, Serine Hydroxymethyltransferase From Salmonella Typhimurium Length = 420 Back     alignment and structure
>pdb|3ECD|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Burkholderia Pseudomallei Length = 425 Back     alignment and structure
>pdb|2VMR|A Chain A, Crystal Structure Of Y60absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2W7I|A Chain A, Crystal Structure Of Y61absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|1DFO|A Chain A, Crystal Structure At 2.4 Angstrom Resolution Of E. Coli Serine Hydroxymethyltransferase In Complex With Glycine And 5-Formyl Tetrahydrofolate Length = 417 Back     alignment and structure
>pdb|3G8M|A Chain A, Serine Hydroxymethyltransferase Y55f Mutant Length = 417 Back     alignment and structure
>pdb|1EQB|A Chain A, X-Ray Crystal Structure At 2.7 Angstroms Resolution Of Ternary Complex Between The Y65f Mutant Of E-Coli Serine Hydroxymethyltransferase, Glycine And 5-Formyl Tetrahydrofolate Length = 417 Back     alignment and structure
>pdb|3PGY|A Chain A, Serine Hydroxymethyltransferase From Staphylococcus Aureus, S95p Mutant. Length = 415 Back     alignment and structure
>pdb|2DKJ|A Chain A, Crystal Structure Of T.Th.Hb8 Serine Hydroxymethyltransferase Length = 407 Back     alignment and structure
>pdb|3H7F|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Mycobacterium Tuberculosis Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 1e-50
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 4e-50
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 2e-22
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 5e-22
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 9e-22
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 1e-21
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 4e-21
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 8e-20
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Length = 483 Back     alignment and structure
 Score =  170 bits (433), Expect = 1e-50
 Identities = 67/126 (53%), Positives = 81/126 (64%), Gaps = 31/126 (24%)

Query: 11  EG----KYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL--- 63
            G    +YYGG + IDE+E + Q+R+L+A+ LDP+ WG NVQPYSGSPANFAVYT L   
Sbjct: 74  LGYPGQRYYGGTEHIDELETLCQKRALQAYGLDPQCWGVNVQPYSGSPANFAVYTALVEP 133

Query: 64  ------------------------KISATSIFFESLPYKVNTETGLIDYDKLAESARLFK 99
                                   KISATSIFFES+ YKVN +TG IDYD+L E+ARLF 
Sbjct: 134 HGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMAYKVNPDTGYIDYDRLEENARLFH 193

Query: 100 PRLIIA 105
           P+LIIA
Sbjct: 194 PKLIIA 199
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} SCOP: c.67.1.4 PDB: 3ou5_A Length = 490 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Length = 405 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Length = 407 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Length = 447 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Length = 425 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} PDB: 1dfo_A* 3g8m_A* 1eqb_A* Length = 420 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} Length = 417 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 100.0
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 99.85
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.78
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.39
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 99.07
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.93
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 98.9
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 98.73
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 98.58
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 98.25
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 97.75
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 97.06
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 97.05
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 96.67
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 96.48
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 96.42
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 96.07
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 96.05
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 96.03
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 95.99
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 95.93
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 95.89
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 95.83
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 95.83
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 95.73
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 95.55
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 95.51
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 95.46
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 95.31
1o69_A 394 Aminotransferase; structural genomics, unknown fun 95.24
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 95.23
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 95.19
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 95.18
3nra_A407 Aspartate aminotransferase; structural genomics, j 95.18
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 95.16
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 95.15
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 95.15
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 95.11
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 95.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 94.98
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 94.98
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 94.96
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 94.87
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 94.87
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 94.84
1svv_A359 Threonine aldolase; structural genomics, structura 94.82
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 94.74
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 94.71
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 94.7
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 94.65
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 94.61
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 94.56
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 94.55
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 94.51
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 94.5
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 94.4
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 94.38
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 94.37
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 94.34
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 94.3
2yrr_A353 Aminotransferase, class V; structural genomics, NP 94.21
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 94.18
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 94.17
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 94.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 93.91
3l8a_A421 METC, putative aminotransferase, probable beta-cys 93.8
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 93.54
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 93.41
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 93.39
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 93.32
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 93.17
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 92.99
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 92.98
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 92.89
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 92.6
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 92.6
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 92.53
3f0h_A376 Aminotransferase; RER070207000802, structural geno 92.47
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 92.45
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 92.43
3rq1_A418 Aminotransferase class I and II; structural genomi 92.31
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 92.06
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 92.0
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 91.99
3ele_A398 Amino transferase; RER070207001803, structural gen 91.88
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 91.83
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 91.7
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 91.69
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 91.65
3pj0_A359 LMO0305 protein; structural genomics, joint center 91.6
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 91.55
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 91.46
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 91.4
2fnu_A 375 Aminotransferase; protein-product complex, structu 91.26
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 91.25
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 91.21
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 91.01
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 90.97
1iug_A352 Putative aspartate aminotransferase; wild type, py 90.74
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 90.68
1xi9_A406 Putative transaminase; alanine aminotransferase, s 90.63
3aow_A448 Putative uncharacterized protein PH0207; protein-P 90.59
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 90.52
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 90.49
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 90.42
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 90.29
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 90.16
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 90.01
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 89.79
2ezd_A26 High mobility group protein HMG-I/HMG-Y; DNA bindi 89.67
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 89.64
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 89.63
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 89.62
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 89.35
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 89.3
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 89.27
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 89.26
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 89.1
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 88.94
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 88.33
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 88.11
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 88.07
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 87.93
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 87.91
1vp4_A425 Aminotransferase, putative; structural genomics, j 87.75
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 87.73
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 87.73
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 87.69
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 87.58
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 87.24
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 87.17
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 86.96
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 86.8
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 86.67
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 86.38
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 86.21
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 86.16
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 85.52
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 85.5
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 85.33
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 85.09
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 85.09
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 84.44
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 84.05
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 83.58
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 82.72
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 81.68
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 80.99
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 80.77
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 80.52
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.7e-46  Score=351.48  Aligned_cols=162  Identities=46%  Similarity=0.733  Sum_probs=125.7

Q ss_pred             cCCCCCCcccCCcccHHHHHHHHHHHHHhhcCCCCCCcccccccCCChhHHHHHHHhh----------------c-----
Q psy10666          6 MSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL----------------K-----   64 (240)
Q Consensus         6 ~~g~pg~ryy~G~~~id~iE~la~~r~~~lF~a~~~~w~~nvqp~SG~~An~av~~al----------------~-----   64 (240)
                      ++||||+|||+||++||+||.||++|||+||+|+||+|+||||||||++||++||+||                |     
T Consensus        83 aEGyPg~RyYgGce~vD~iE~la~~rak~lF~a~~A~w~VNVQP~SGs~AN~avy~All~PGD~ilg~~l~~GGHltHg~  162 (490)
T 3ou5_A           83 SEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGY  162 (490)
T ss_dssp             CCC----------CHHHHHHHHHHHHHHHHTTCCTTTEEEECCCSSHHHHHHHHHHHHCC-CCCEECBC-----------
T ss_pred             cCCCCCccccCCChHHHHHHHHHHHHHHHHhCCCccccCCCCCcCCHHHHHHHHHHHHcCCCCEEEecccCCCCcccccc
Confidence            6899999999999999999999999999999999999999999999999999999999                2     


Q ss_pred             ------cCcccccceeeeccccCCCcccChHHHHHHHHhhCCCEEEEecccccchhhhhhhhhhhHHHHHhhHHHHhhhC
Q psy10666         65 ------ISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYN  138 (240)
Q Consensus        65 ------~s~~g~~~~~~~y~~d~~~~~ID~d~~~~~a~~~kPkLIi~G~S~y~r~~d~~~l~E~~~w~~~~N~eIr~~~d  138 (240)
                            +|++|++|++++|+||++|+.||||+++++|+++||||||+|+|+|+|++|+++++|     ++...+....+|
T Consensus       163 ~~~~~~v~~sg~~~~~~~Y~vd~~t~~IDyd~~~~~A~~~kPklIi~G~SaY~r~id~~~~re-----IAd~vGA~Lm~D  237 (490)
T 3ou5_A          163 MSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMRE-----VCDEVKAHLLAD  237 (490)
T ss_dssp             -----------------CBCEETTTTEECHHHHHHHHHHHCCSEEEECCSSCCSCCCHHHHHH-----HHHHHTCEEEEE
T ss_pred             cCCCcccccccccccccccccCCCCCcccHHHHHHHHhhcCCCeEEECCccCccccCHHHHHH-----HHhhcccEEEec
Confidence                  456788999999999999999999999999999999999999999999999999999     788899999999


Q ss_pred             CCchhhhhhccceeeeccccccCCCchhh--hhhh-hcCCCCCCCCC
Q psy10666        139 EPDVVGEIKSGRLRWAGHVQRREEDSNIR--SIWE-HQPEGRRPRGR  182 (240)
Q Consensus       139 ~s~Il~~I~~rrl~WaGHV~R~~~~~~~k--~v~~-~~~~gkR~rGR  182 (240)
                      ++|+.++|.++.+          +++++.  .|++ ...+-+.|||.
T Consensus       238 mAHiaGLVA~g~~----------psP~~~ADvVTtTTHKTLrGPrGG  274 (490)
T 3ou5_A          238 MAHISGLVAAKVI----------PSPFKHADIVTTTTHKTLRGARSG  274 (490)
T ss_dssp             CGGGHHHHHTTSS----------CCGGGTCSEEEEESSSTTCSCSCE
T ss_pred             hhhhhhhhccccc----------CCccccceEEeccccccccCCCce
Confidence            9999999988843          233332  2332 24577788886
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>2ezd_A High mobility group protein HMG-I/HMG-Y; DNA binding protein, minor groove DNA binding, transcriptional CO-activator, architectural factor; HET: DNA; NMR {Homo sapiens} SCOP: j.10.1.1 PDB: 2eze_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
d2a7va1 463 c.67.1.4 (A:26-488) Serine hydroxymethyltransferas 1e-22
d1rv3a_ 470 c.67.1.4 (A:) Serine hydroxymethyltransferase {Rab 2e-21
d1kl1a_ 405 c.67.1.4 (A:) Serine hydroxymethyltransferase {Bac 5e-15
d1dfoa_ 416 c.67.1.4 (A:) Serine hydroxymethyltransferase {Esc 2e-14
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Serine hydroxymethyltransferase
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

 Score = 93.6 bits (232), Expect = 1e-22
 Identities = 67/120 (55%), Positives = 84/120 (70%), Gaps = 27/120 (22%)

Query: 13  KYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL--------- 63
           +YYGG + +DEIE++ Q+R+L+AF+LDP QWG NVQPYSGSPAN AVYT L         
Sbjct: 63  RYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMG 122

Query: 64  ------------------KISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIA 105
                             +ISATSIFFES+PYK+N +TGLIDY++LA +ARLF+PRLIIA
Sbjct: 123 LDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIA 182
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 470 Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 405 Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 100.0
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 100.0
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 100.0
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 100.0
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.56
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 98.26
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 97.95
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 97.63
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 97.37
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 96.85
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 95.72
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 95.65
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 95.08
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 94.88
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 94.57
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 94.47
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 94.19
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 93.72
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 92.94
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 92.38
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 91.36
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 91.27
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 89.96
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 86.27
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 85.35
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 84.71
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 82.73
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 80.15
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Serine hydroxymethyltransferase
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=100.00  E-value=7.2e-42  Score=321.30  Aligned_cols=141  Identities=51%  Similarity=0.848  Sum_probs=111.7

Q ss_pred             cCCCCCCcccCCcccHHHHHHHHHHHHHhhcCCCCCCcccccccCCChhHHHHHHHhh----------------c-----
Q psy10666          6 MSSDEEGKYYGGNQFIDEIEIVAQQRSLKAFNLDPEQWGCNVQPYSGSPANFAVYTGL----------------K-----   64 (240)
Q Consensus         6 ~~g~pg~ryy~G~~~id~iE~la~~r~~~lF~a~~~~w~~nvqp~SG~~An~av~~al----------------~-----   64 (240)
                      ++||||+|||+||+++|+||.||++||++||+|+||+|+|||||+||++||++||.||                |     
T Consensus        56 aeG~pg~Ryy~G~~~iD~iE~la~~ra~~lF~~~~a~w~vNVqp~SGs~An~av~~all~pgD~Im~l~l~~GGHlshg~  135 (463)
T d2a7va1          56 SEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGY  135 (463)
T ss_dssp             CCC------------CTHHHHHHHHHHHHHTTCCTTTEEEECCCSSHHHHHHHHHHHHCCSCEECCC-------------
T ss_pred             cCCCCCccccCCchhHHHHHHHHHHHHHHHhCCCchhccCCccccccHHHHHHHHHHHcCCCceEEeeccCcCccccccc
Confidence            5699999999999999999999999999999999999999999999999999999999                2     


Q ss_pred             ------cCcccccceeeeccccCCCcccChHHHHHHHHhhCCCEEEEecccccchhhhhhhhhhhHHHHHhhHHHHhhhC
Q psy10666         65 ------ISATSIFFESLPYKVNTETGLIDYDKLAESARLFKPRLIIAETIEDLKLLTKVLLEETSKWRIKHNREIRDLYN  138 (240)
Q Consensus        65 ------~s~~g~~~~~~~y~~d~~~~~ID~d~~~~~a~~~kPkLIi~G~S~y~r~~d~~~l~E~~~w~~~~N~eIr~~~d  138 (240)
                            ++++|++|++++|++|++++.||||+++++|+++||||||+|+|+|||++|+++++|     ++...+....+|
T Consensus       136 ~~~~~~~~~~g~~~~~~~Y~~d~~~~~IDyd~~~~~a~~~kPklIi~G~S~y~r~~d~~~~re-----Iad~vga~l~~D  210 (463)
T d2a7va1         136 MSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMRE-----VCDEVKAHLLAD  210 (463)
T ss_dssp             ------------------CCBCTTTCSBCHHHHHHHHHHHCCSEEEECCSSCCSCCCHHHHHH-----HHHHTTCEEEEE
T ss_pred             ccccccccceeeEeeeeeeeccCCCCcCcHHHHHHHHhhcCCceEEecccccccccCHHHHHH-----HhhcccceEEec
Confidence                  345678899999999999999999999999999999999999999999999999999     778889999999


Q ss_pred             CCchhhhhhccce
Q psy10666        139 EPDVVGEIKSGRL  151 (240)
Q Consensus       139 ~s~Il~~I~~rrl  151 (240)
                      ++|+.++|.++.+
T Consensus       211 ~aH~aGLIA~g~~  223 (463)
T d2a7va1         211 MAHISGLVAAKVI  223 (463)
T ss_dssp             CGGGHHHHHTTSS
T ss_pred             hhhhhHHhhhhhh
Confidence            9999999987744
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure