Diaphorina citri psyllid: psy10678


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MTPNPTSCCSGKGPGYRTPVDAMRYGPRETLLYVICIQPNGQHPDYLAVIDVDPQSKTYQQVRNTLRAGLAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDVSV
ccccccccccccccccccHHHHHHcccccccEEEEEEEcccccccEEEEEEccccccccHHHcHHHHcccccEEEEEEcccccEEEEEccccccEEEEEcccccccCEEEEEEEcEEEccccccEEcccccccccc
************GPGYRTPVDAMRYGPRETLLYVICIQPNGQHPDYLAVIDVDPQSKTYQQVRNTLRAGLAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTV****ELDV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPNPTSCCSGKGPGYRTPVDAMRYGPRETLLYVICIQPNGQHPDYLAVIDVDPQSKTYQQVRNTLRAGLAMVTDILISLDDRYLYTSNWMHGDIRQYDIRDTAHPVLVGQIFLGGKIQSDSGVTVIDDPELDVSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Selenium-binding protein 1 Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport.confidentQ13228
Selenium-binding protein 1 Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport.confidentQ569D5
Selenium-binding protein 1 Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport.confidentQ5RF48

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071291 [BP]cellular response to selenium ionprobableGO:0051716, GO:0071248, GO:0070887, GO:0010269, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0010038, GO:0042221, GO:0010035, GO:0050896, GO:0044699
GO:0042542 [BP]response to hydrogen peroxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050873 [BP]brown fat cell differentiationprobableGO:0032502, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0044763, GO:0045444, GO:0044699
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ECE, chain A
Confidence level:very confident
Coverage over the Query: 12-112
View the alignment between query and template
View the model in PyMOL