Diaphorina citri psyllid: psy10688

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MVEFYTLKYHNEKRELHLLPPLSYNKQLSALALDWANQLLEADKFSHRPDNKFGENIFFYTSSFYVDDKEAIKKAVTAWYNEIEDYREYFDLEPPLEALTTGNPTGHFTQVVWNGTTEVGLGLSRNASSDFHKVIVVANYAPPGNILGRFKENVPMPAEWKKKKSQRRK

cHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEcccccccccccECccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccEEEEEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccc

MVEFYTLKYHNEKRELHLLPPLSYNKQLSALALDWANQLLEADKFSHRPDNKFGENIFFYTSSFYVDDKEAIKKAVTAWYNEIEDYREYFDLEPPLEALTTGNPTGHFTQVVWNGTTEVGLGLSRNASSDFHKVIVVANYAPPGNILGRFKENV***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVEFYTLKYHNEKRELHLLPPLSYNKQLSALALDWANQLLEADKFSHRPDNKFGENIFFYTSSFYVDDKEAIKKAVTAWYNEIEDYREYFDLEPPLEALTTGNPTGHFTQVVWNGTTEVGLGLSRNASSDFHKVIVVANYAPPGNILGRFKENVPMPAEWKKKKSQRRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Golgi-associated plant pathogenesis-related protein 1		confident	Q9CYL5
Golgi-associated plant pathogenesis-related protein 1		confident	Q9H4G4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]	biological_process	probable
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NT8, chain A
Confidence level:very confident
Coverage over the Query: 2-164
View the alignment between query and template
View the model in PyMOL