Diaphorina citri psyllid: psy10688


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MVEFYTLKYHNEKRELHLLPPLSYNKQLSALALDWANQLLEADKFSHRPDNKFGENIFFYTSSFYVDDKEAIKKAVTAWYNEIEDYREYFDLEPPLEALTTGNPTGHFTQVVWNGTTEVGLGLSRNASSDFHKVIVVANYAPPGNILGRFKENVPMPAEWKKKKSQRRK
cHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEcccccccccccECccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccEEEEEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccc
MVEFYTLKYHNEKRELHLLPPLSYNKQLSALALDWANQLLEADKFSHRPDNKFGENIFFYTSSFYVDDKEAIKKAVTAWYNEIEDYREYFDLEPPLEALTTGNPTGHFTQVVWNGTTEVGLGLSRNASSDFHKVIVVANYAPPGNILGRFKENV***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEFYTLKYHNEKRELHLLPPLSYNKQLSALALDWANQLLEADKFSHRPDNKFGENIFFYTSSFYVDDKEAIKKAVTAWYNEIEDYREYFDLEPPLEALTTGNPTGHFTQVVWNGTTEVGLGLSRNASSDFHKVIVVANYAPPGNILGRFKENVPMPAEWKKKKSQRRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi-associated plant pathogenesis-related protein 1 confidentQ9CYL5
Golgi-associated plant pathogenesis-related protein 1 confidentQ9H4G4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]biological_processprobable
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NT8, chain A
Confidence level:very confident
Coverage over the Query: 2-164
View the alignment between query and template
View the model in PyMOL