Diaphorina citri psyllid: psy106


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MDLKDKCAIRVENAYKRHSSKLPYVLDKLCMTVQKSTIYSLLGASGCGKTTLLSCITGQNVLNGGNIHLSITSKKQLGFMPQQISLYPEFTIDEMICYYGLIYGMSLQQIKEKAEYLQALLHLNHFKRKCGSLSGGQQRRVSLAITLLHDPELLILDEPTSGIDPVIAEEIWNHLLYLAESGRTILITTHYIDEAKKSHMIGLMRKGILLEESPPKVLLEKYNMKSLEDVFLLLSSKQQHDRIEQRRKSFLWPIQAIQEHTRYLANFLPLTYPIDSFRSIVFRGFDIFHWQVYYGFLSSTGWIVGLTLVCWILLRYKNGLV
cccccccEEEEcccEEEcccccccccccEEEEEccccEEEEEccccccHHHHHHHHHcccccccCEEEEcccccccCEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHccEEEEECccEEEEEccHHHHHHccccccHHHHHHHccHHHcccHHHHHHcccccHHHHHHHHHHHHccccccccccccEEEEEEEcEEEEccEEEEHHHHHHHHHHHHHHHHHHHHHHccccc
*****KCAIRVENAYKRHSSKLPYVLDKLCMTVQKSTIYSLLGASGCGKTTLLSCITGQNVLNGGNIHLSITSKKQLGFMPQQISLYPEFTIDEMICYYGLIYGMSLQQIKEKAEYLQALLHLNHFKRKCGSLSGGQQRRVSLAITLLHDPELLILDEPTSGIDPVIAEEIWNHLLYLAESGRTILITTHYIDEAKKSHMIGLMRKGILLEESPPKVLLEKYNMKSLEDVFLLLSS*****RIEQRRKSFLWPIQAIQEHTRYLANFLPLTYPIDSFRSIVFRGFDIFHWQVYYGFLSSTGWIVGLTLVCWILLRYKNGL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLKDKCAIRVENAYKRHSSKLPYVLDKLCMTVQKSTIYSLLGASGCGKTTLLSCITGQNVLNGGNIHLSITSKKQLGFMPQQISLYPEFTIDEMICYYGLIYGMSLQQIKEKAEYLQALLHLNHFKRKCGSLSGGQQRRVSLAITLLHDPELLILDEPTSGIDPVIAEEIWNHLLYLAESGRTILITTHYIDEAKKSHMIGLMRKGILLEESPPKVLLEKYNMKSLEDVFLLLSSKQQHDRIEQRRKSFLWPIQAIQEHTRYLANFLPLTYPIDSFRSIVFRGFDIFHWQVYYGFLSSTGWIVGLTLVCWILLRYKNGLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nod factor export ATP-binding protein I Part of the ABC transporter complex NodIJ involved in the export of the nodulation factors (Nod factors), the bacterial signal molecules that induce symbiosis and subsequent nodulation induction. Nod factors are LCO (lipo-chitin oligosaccharide), a modified beta-1,4-linked N-acetylglucosamine oligosaccharide. This subunit is responsible for energy coupling to the transport system.confidentQ39GT7
Nod factor export ATP-binding protein I Part of the ABC transporter complex NodIJ involved in the export of the nodulation factors (Nod factors), the bacterial signal molecules that induce symbiosis and subsequent nodulation induction. Nod factors are LCO (lipo-chitin oligosaccharide), a modified beta-1,4-linked N-acetylglucosamine oligosaccharide. This subunit is responsible for energy coupling to the transport system.confidentQ1BWI2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0022892 [MF]substrate-specific transporter activityprobableGO:0005215, GO:0003674
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 6-212
View the alignment between query and template
View the model in PyMOL
Template: 1VPL, chain A
Confidence level:very confident
Coverage over the Query: 7-232
View the alignment between query and template
View the model in PyMOL