Diaphorina citri psyllid: psy10708


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MLISSHMNVPNPPAPASSQPQQSTSAGSNPGGGGAVSPPHQNGYTSTSSSSGGTSGSPGPGYKSDNEEQEKRDELDSLITAITTNGSHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARIWRWPDLHKNELKHLKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLSLQSGSNRLVKDEYSAGVTSTAPVLPTTGGMDVDGEAGSSGLLSNQPPPEYWCSVAYFELDTQVGETFKVPSSCPNTHPGAIDSVWEPYPMYIARTRVNEPGNTSILLPYFELDTQVGETFKVPSSCPNVTIDGYVDPSGGNRFCLGALSNVHRTDQSERARFSKESGLQTSCLFSPTGSSGLLSNQPPPEYWCSVAYFELDTQVGETFKVPSSCPNVTIDGYVDPSGGNRFCLGALSNVHRTDQSERARLHIGKGVQLDLRGEGDVWLHCLSDHSVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCYRQMQQQAATAQAAAAAQAAAVAGHIPGPHSVGGIAPAISLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKETPCWVEVHLHRALQLLDEVLHTMPIDGHRALE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccEEEEEEEEEccccccccccccccccccccccccCEEEccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccCEECcccccEEEEcccccccccccEEccccccccccHHHHHHHHHHcccEEEEEEccccEEEEccccccEEEEcccccccccccccccEEECcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEECcccccccccccccccCEEEEEHHHHHHHHHHHHcccccccccccc
*********************************************************************EKRDELDSLITAITTNGSHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARIWRWPDLHKNELKHLKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLSLQ**********************************************EYWCSVAYFELDTQVGETFKVPSSCPNTHPGAIDSVWEPYPMYIARTRVNEPGNTSILLPYFELDTQVGETFKVPSSCPNVTIDGYVDPSGGNRFCLGALSNV*******RARFSKESGLQTSCLFSP**S******QPPPEYWCSVAYFELDTQVGETFKVPSSCPNVTIDGYVDPSGGNRFCLGALSNVHRTDQSERARLHIGKGVQLDLRGEGDVWLHCLSDHSVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCYRQMQ********AAAAQAAAVAGHIPGPHSVGGIAPAISLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKETPCWVEVHLHRALQLLDEVLHTMPI*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLISSHMNVPNPPAPASSQPQQSTSAGSNPGGGGAVSPPHQNGYTSTSSSSGGTSGSPGPGYKSDNEEQEKRDELDSLITAITTNGSHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARIWRWPDLHKNELKHLKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLSLQSGSNRLVKDEYSAGVTSTAPVLPTTGGMDVDGEAGSSGLLSNQPPPEYWCSVAYFELDTQVGETFKVPSSCPNTHPGAIDSVWEPYPMYIARTRVNEPGNTSILLPYFELDTQVGETFKVPSSCPNVTIDGYVDPSGGNRFCLGALSNVHRTDQSERARFSKESGLQTSCLFSPTGSSGLLSNQPPPEYWCSVAYFELDTQVGETFKVPSSCPNVTIDGYVDPSGGNRFCLGALSNVHRTDQSERARLHIGKGVQLDLRGEGDVWLHCLSDHSVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCYRQMQQQAATAQAAAAAQAAAVAGHIPGPHSVGGIAPAISLSAAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKETPCWVEVHLHRALQLLDEVLHTMPIDGHRALE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mothers against decapentaplegic homolog 4 Common SMAD (co-SMAD) is the coactivator and mediator of signal transduction by TGF-beta (transforming growth factor). Component of the heterotrimeric SMAD2/SMAD3-SMAD4 complex that forms in the nucleus and is required for the TGF-mediated signaling. Promotes binding of the SMAD2/SMAD4/FAST-1 complex to DNA and provides an activation function required for SMAD1 or SMAD2 to stimulate transcription. Component of the multimeric SMAD3/SMAD4/JUN/FOS complex which forms at the AP1 promoter site; required for syngernistic transcriptional activity in response to TGF-beta. May act as a tumor suppressor. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.confidentQ13485
Mothers against decapentaplegic homolog 4 Common SMAD (co-SMAD) is the coactivator and mediator of signal transduction by TGF-beta (transforming growth factor). Component of the heterotrimeric SMAD2/SMAD3-SMAD4 complex that forms in the nucleus and is required for the TGF-mediated signaling. Promotes binding of the SMAD2/SMAD4/FAST-1 complex to DNA and provides an activation function required for SMAD1 or SMAD2 to stimulate transcription. Component of the multimeric SMAD3/SMAD4/JUN/FOS complex which forms at the AP1 promoter site; required for syngernistic transcriptional activity in response to TGF-beta. May act as a tumor suppressor. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.confidentP97471
Mothers against decapentaplegic homolog 4 Common SMAD (co-SMAD) is the coactivator and mediator of signal transduction by TGF-beta (transforming growth factor). Component of the heterotrimeric SMAD2/SMAD3-SMAD4 complex that forms in the nucleus and is required for the TGF-mediated signaling. Promotes binding of the SMAD2/SMAD4/FAST-1 complex to DNA and provides an activation function required for SMAD1 or SMAD2 to stimulate transcription. Component of the multimeric SMAD3/SMAD4/JUN/FOS complex which forms at the AP1 promoter site; required for syngernistic transcriptional activity in response to TGF-beta. May act as a tumor suppressor. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.confidentQ9GKQ9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005575 [CC]cellular_componentconfident
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0000988 [MF]protein binding transcription factor activityprobableGO:0003674
GO:0042177 [BP]negative regulation of protein catabolic processprobableGO:0051248, GO:0009895, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0009894, GO:0008150, GO:0042176, GO:0065007, GO:0048519, GO:0009892, GO:0050789
GO:0032444 [CC]activin responsive factor complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0030616 [MF]transforming growth factor beta receptor, common-partner cytoplasmic mediator activityprobableGO:0005057, GO:0005072, GO:0003674, GO:0004871, GO:0060089
GO:0007183 [BP]SMAD protein complex assemblyprobableGO:0022607, GO:0070271, GO:0043933, GO:0007167, GO:0023052, GO:0007165, GO:0007166, GO:0034622, GO:0050789, GO:0044699, GO:0051716, GO:0071822, GO:0016043, GO:0065003, GO:0065007, GO:0071840, GO:0009987, GO:0006461, GO:0050794, GO:0044763, GO:0007154, GO:0043623, GO:0007178, GO:0044700, GO:0050896, GO:0044085, GO:0008150
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0060395 [BP]SMAD protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0030513 [BP]positive regulation of BMP signaling pathwayprobableGO:0090092, GO:0010646, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0050789, GO:0030510
GO:0030511 [BP]positive regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0017015, GO:0090092, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0000987 [MF]core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0000975, GO:0001067, GO:0001159, GO:0000976, GO:0005488, GO:0003676, GO:0003677, GO:0003674, GO:1901363
GO:0051098 [BP]regulation of bindingprobableGO:0008150, GO:0065009, GO:0065007
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0071141 [CC]SMAD protein complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0070412 [MF]R-SMAD bindingprobableGO:0046332, GO:0003674, GO:0005488, GO:0005515
GO:0070411 [MF]I-SMAD bindingprobableGO:0046332, GO:0003674, GO:0005488, GO:0005515
GO:0032909 [BP]regulation of transforming growth factor beta2 productionprobableGO:0050789, GO:0001817, GO:0008150, GO:0051239, GO:0065007, GO:0071634
GO:0014033 [BP]neural crest cell differentiationprobableGO:0032502, GO:0048762, GO:0048863, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0009888, GO:0008150, GO:0048513, GO:0044763, GO:0048731, GO:0060485, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0060548 [BP]negative regulation of cell deathprobableGO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0010862 [BP]positive regulation of pathway-restricted SMAD protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0010647, GO:0010646, GO:0050789, GO:0080090, GO:0010604, GO:0090100, GO:0009966, GO:0009967, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0090092, GO:0045937, GO:0060255, GO:0031323, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0060393, GO:0001932, GO:0001934, GO:0048522
GO:0007492 [BP]endoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0007498 [BP]mesoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0001658 [BP]branching involved in ureteric bud morphogenesisprobableGO:0048754, GO:0001763, GO:0060675, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0072001, GO:0032502, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0001655, GO:0001657, GO:0035295, GO:0044707, GO:0048856, GO:0048731
GO:0010718 [BP]positive regulation of epithelial to mesenchymal transitionprobableGO:0022604, GO:2000736, GO:0022603, GO:0051128, GO:0050789, GO:0060284, GO:0010769, GO:0065007, GO:0010720, GO:0048518, GO:0051130, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0010717, GO:2000026, GO:0010770, GO:0048522
GO:0001702 [BP]gastrulation with mouth forming secondprobableGO:0048598, GO:0032502, GO:0048856, GO:0044707, GO:0007369, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0060021 [BP]palate developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0032525 [BP]somite rostral/caudal axis specificationprobableGO:0009790, GO:0009792, GO:0000578, GO:0009798, GO:0035282, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0009948, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0009880, GO:0044767, GO:0008150, GO:0003002, GO:0001756, GO:0061053, GO:0009952, GO:0044707, GO:0048856
GO:0048859 [BP]formation of anatomical boundaryprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0048646, GO:0009653, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0031005 [MF]filamin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048733 [BP]sebaceous gland developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0030509 [BP]BMP signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0060391 [BP]positive regulation of SMAD protein import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0048584, GO:0048583, GO:0070201, GO:0023056, GO:0023051, GO:0010647, GO:0010646, GO:0051222, GO:0032880, GO:0051223, GO:0090100, GO:0009966, GO:0009967, GO:0050789, GO:0065007, GO:0048518, GO:0090092, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:1900180, GO:0060390, GO:0046824, GO:0046822, GO:0048522
GO:0005518 [MF]collagen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0003360 [BP]brainstem developmentprobableGO:0044767, GO:0032502, GO:0048856, GO:0008150, GO:0044699
GO:0051797 [BP]regulation of hair follicle developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:2000026, GO:0051239, GO:0045682, GO:0050789, GO:0042634
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0072133 [BP]metanephric mesenchyme morphogenesisprobableGO:0072132, GO:0072131, GO:0009653, GO:0007275, GO:0044699, GO:0072075, GO:0001822, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0009888, GO:0072074, GO:0044767, GO:0008150, GO:0001655, GO:0001656, GO:0060485, GO:0072001, GO:0044707, GO:0048856, GO:0048731
GO:0072134 [BP]nephrogenic mesenchyme morphogenesisprobableGO:0072076, GO:0072132, GO:0072131, GO:0009653, GO:0007275, GO:0044699, GO:0001822, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0009888, GO:0072074, GO:0044767, GO:0008150, GO:0001655, GO:0060485, GO:0072001, GO:0072006, GO:0044707, GO:0048856, GO:0048731
GO:0048663 [BP]neuron fate commitmentprobableGO:0032502, GO:0048699, GO:0045165, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YGS, chain A
Confidence level:very confident
Coverage over the Query: 356-482,518-580
View the alignment between query and template
View the model in PyMOL
Template: 1DD1, chain A
Confidence level:very confident
Coverage over the Query: 344-487,514-582
View the alignment between query and template
View the model in PyMOL
Template: 3QSV, chain A
Confidence level:very confident
Coverage over the Query: 41-159
View the alignment between query and template
View the model in PyMOL