Diaphorina citri psyllid: psy10722


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE
ccccccccEEEEEcCCccccccccccccccccEEEEEcccEEEEEEEEccccccEEEEEcccccccHHHHHHHcccHHHHHHHcccEEEEEccccccccccccccc
*****MDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQ**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein NDRG2 Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor (By similarity). May be involved in dendritic cell and neuron differentiation.confidentQ8VBU2
Protein NDRG2 Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation.confidentQ9QYG0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048662 [BP]negative regulation of smooth muscle cell proliferationprobableGO:0042127, GO:0008285, GO:0048660, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QMQ, chain A
Confidence level:very confident
Coverage over the Query: 34-102
View the alignment between query and template
View the model in PyMOL