Psyllid ID: psy10722

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE
ccccccccEEEEEcEEccccccccccccccccEEEEEcccEEEEEEEEccccccEEEEEcccccccHHHHHHHcccHHHHHHHcccEEEEEccccccccccccccc
ccccccccEEEEEEcccccccccHHcccccccEEEEEccccEEEEEEEccccccEEEEEcccccccHHHcHHHcccHHHHHHHHccEEEEEccccccccccccccc
mqaesmddvdlrqvqlsipltrslartdptvEEVYVETDRGSILVAVagnrgkpailTYHDLGLNYISNFQAFFNFSDMRSLLENFSvyhvnapgqeegaqplade
mqaesmddvdlrqvqlsipltrslartdptveevyvetdrgsilvavagnrGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVnapgqeegaqplade
MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE
***************LSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVN**************
****SMDDVDLRQVQLSI**********PTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQE*********
**********LRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQ**********
*****MDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAP************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
Q3ZBA8 357 Protein NDRG2 OS=Bos taur yes N/A 0.830 0.246 0.479 3e-15
Q5RA95 375 Protein NDRG3 OS=Pongo ab yes N/A 0.867 0.245 0.419 4e-15
Q9UGV2 375 Protein NDRG3 OS=Homo sap yes N/A 0.867 0.245 0.419 5e-15
A7MB28 375 Protein NDRG3 OS=Bos taur no N/A 0.867 0.245 0.419 6e-15
Q6GQL1 375 Protein NDRG3 OS=Xenopus N/A N/A 0.858 0.242 0.415 2e-14
Q6DFS4 387 Protein NDRG3 OS=Xenopus yes N/A 0.650 0.178 0.492 2e-14
Q4R4K0 357 Protein NDRG2 OS=Macaca f N/A N/A 0.830 0.246 0.458 2e-14
A5A6K6 357 Protein NDRG2 OS=Pan trog no N/A 0.858 0.254 0.440 3e-14
Q5RBN6 371 Protein NDRG2 OS=Pongo ab no N/A 0.613 0.175 0.552 4e-14
Q9UN36 371 Protein NDRG2 OS=Homo sap no N/A 0.613 0.175 0.552 4e-14
>sp|Q3ZBA8|NDRG2_BOVIN Protein NDRG2 OS=Bos taurus GN=NDRG2 PE=2 SV=1 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 61/96 (63%), Gaps = 8/96 (8%)

Query: 10  DLRQVQLS--IPLTRSLARTDPTVEEVY-VETDRGSILVAVAG--NRGKPAILTYHDLGL 64
           +LR+VQ++   PL   L    P V + + VET  GS+   V G     +PAILTYHD+GL
Sbjct: 3   ELREVQITEEKPL---LPGQTPEVAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGL 59

Query: 65  NYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGA 100
           NY S FQ  F F+DM+ +++NF   HV+APG EEGA
Sbjct: 60  NYKSCFQPLFQFADMQEIIQNFVRVHVDAPGMEEGA 95
Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation.
Bos taurus (taxid: 9913)
>sp|Q5RA95|NDRG3_PONAB Protein NDRG3 OS=Pongo abelii GN=NDRG3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UGV2|NDRG3_HUMAN Protein NDRG3 OS=Homo sapiens GN=NDRG3 PE=1 SV=2 Back     alignment and function description
>sp|A7MB28|NDRG3_BOVIN Protein NDRG3 OS=Bos taurus GN=NDRG3 PE=2 SV=1 Back     alignment and function description
>sp|Q6GQL1|NDRG3_XENLA Protein NDRG3 OS=Xenopus laevis GN=ndrg3 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFS4|NDRG3_XENTR Protein NDRG3 OS=Xenopus tropicalis GN=ndrg3 PE=2 SV=1 Back     alignment and function description
>sp|Q4R4K0|NDRG2_MACFA Protein NDRG2 OS=Macaca fascicularis GN=NDRG2 PE=2 SV=1 Back     alignment and function description
>sp|A5A6K6|NDRG2_PANTR Protein NDRG2 OS=Pan troglodytes GN=NDRG2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBN6|NDRG2_PONAB Protein NDRG2 OS=Pongo abelii GN=NDRG2 PE=2 SV=2 Back     alignment and function description
>sp|Q9UN36|NDRG2_HUMAN Protein NDRG2 OS=Homo sapiens GN=NDRG2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
328779207 474 PREDICTED: protein NDRG3-like isoform 1 1.0 0.223 0.688 2e-36
380029331 417 PREDICTED: protein NDRG3-like [Apis flor 1.0 0.254 0.688 2e-36
340714827 474 PREDICTED: protein NDRG3-like [Bombus te 1.0 0.223 0.679 4e-36
383865146 474 PREDICTED: protein NDRG3-like [Megachile 1.0 0.223 0.679 5e-36
322798809 383 hypothetical protein SINV_01907 [Solenop 1.0 0.276 0.679 6e-36
270004618 467 hypothetical protein TcasGA2_TC003984 [T 1.0 0.226 0.650 7e-36
91080001 421 PREDICTED: similar to Misexpression supp 1.0 0.251 0.650 8e-36
307191741 368 Protein NDRG3 [Harpegnathos saltator] 1.0 0.288 0.679 8e-36
307180851 383 Protein NDRG3 [Camponotus floridanus] 1.0 0.276 0.679 1e-35
345497246 476 PREDICTED: protein NDRG3-like [Nasonia v 1.0 0.222 0.660 2e-35
>gi|328779207|ref|XP_396456.4| PREDICTED: protein NDRG3-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 86/106 (81%)

Query: 1   MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYH 60
           M ++SMDD++L+ +QL  P  R L+R D +V E  VETD+GSILVAV GNR KPAILTYH
Sbjct: 92  MPSDSMDDIELKNIQLQFPPLRCLSRDDSSVREERVETDKGSILVAVQGNRAKPAILTYH 151

Query: 61  DLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE 106
           DLGLNYIS+FQAFFN+ DMR LLENF VYHVNAPGQEEGA  L ++
Sbjct: 152 DLGLNYISSFQAFFNYIDMRVLLENFCVYHVNAPGQEEGAPTLPED 197

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380029331|ref|XP_003698329.1| PREDICTED: protein NDRG3-like [Apis florea] Back     alignment and taxonomy information
>gi|340714827|ref|XP_003395925.1| PREDICTED: protein NDRG3-like [Bombus terrestris] gi|350415000|ref|XP_003490499.1| PREDICTED: protein NDRG3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383865146|ref|XP_003708036.1| PREDICTED: protein NDRG3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322798809|gb|EFZ20356.1| hypothetical protein SINV_01907 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|270004618|gb|EFA01066.1| hypothetical protein TcasGA2_TC003984 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080001|ref|XP_971273.1| PREDICTED: similar to Misexpression suppressor of KSR 2 CG15669-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307191741|gb|EFN75183.1| Protein NDRG3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307180851|gb|EFN68689.1| Protein NDRG3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345497246|ref|XP_001600170.2| PREDICTED: protein NDRG3-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
FB|FBgn0043070 485 MESK2 "Misexpression suppresso 0.981 0.214 0.537 1.4e-24
UNIPROTKB|F1NRQ2 375 F1NRQ2 "Uncharacterized protei 0.905 0.256 0.438 4.1e-15
UNIPROTKB|F1S479 271 NDRG3 "Uncharacterized protein 0.886 0.346 0.417 4.2e-15
UNIPROTKB|E2QSC7 375 NDRG3 "Uncharacterized protein 0.886 0.250 0.427 5.3e-15
UNIPROTKB|E2QSD6 388 NDRG3 "Uncharacterized protein 0.886 0.242 0.427 5.9e-15
UNIPROTKB|A7MB28 375 NDRG3 "Protein NDRG3" [Bos tau 0.886 0.250 0.427 8.8e-15
UNIPROTKB|Q9UGV2 375 NDRG3 "Protein NDRG3" [Homo sa 0.886 0.250 0.427 8.8e-15
UNIPROTKB|F1MTZ1 356 NDRG2 "Protein NDRG2" [Bos tau 0.849 0.252 0.468 9.5e-15
UNIPROTKB|Q3ZBA8 357 NDRG2 "Protein NDRG2" [Bos tau 0.849 0.252 0.468 9.6e-15
UNIPROTKB|E1BYD4 402 NDRG1 "Uncharacterized protein 0.933 0.246 0.423 1.1e-14
FB|FBgn0043070 MESK2 "Misexpression suppressor of KSR 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 1.4e-24, P = 1.4e-24
 Identities = 57/106 (53%), Positives = 70/106 (66%)

Query:     1 MQAESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRGKPAILTYH 60
             M  + MDD++LR VQL  P  R         E+  V TD+G + VA+ G+  KPAI+TYH
Sbjct:    18 MPVDPMDDIELRSVQLQFPNARGSILE--ACEQRRVPTDKGDVHVAIQGDTAKPAIITYH 75

Query:    61 DLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQPLADE 106
             DLGLNY ++F  FFNF  MR LLENF VYHV APGQEEGA  L ++
Sbjct:    76 DLGLNYATSFAGFFNFPVMRGLLENFCVYHVTAPGQEEGAPTLPED 121
GO:0046579 "positive regulation of Ras protein signal transduction" evidence=IGI
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1NRQ2 F1NRQ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S479 NDRG3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSC7 NDRG3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSD6 NDRG3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB28 NDRG3 "Protein NDRG3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UGV2 NDRG3 "Protein NDRG3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTZ1 NDRG2 "Protein NDRG2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBA8 NDRG2 "Protein NDRG2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYD4 NDRG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VBU2NDRG2_RATNo assigned EC number0.53730.61320.1752yesN/A
Q9QYG0NDRG2_MOUSENo assigned EC number0.53730.61320.1752yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
pfam03096 284 pfam03096, Ndr, Ndr family 1e-28
>gnl|CDD|190521 pfam03096, Ndr, Ndr family Back     alignment and domain information 
 Score =  103 bits (260), Expect = 1e-28
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 33  EVYVETDRGSILVAVAGNR--GKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYH 90
           E  +ET  GS+ V V G+    KP ILTYHDLGLN+ S FQ  FN   M+ +L+NF +YH
Sbjct: 1   EHIIETPCGSVHVTVYGDPKGKKPPILTYHDLGLNHKSCFQGLFNSESMQEILQNFCIYH 60

Query: 91  VNAPGQEEGAQPLAD 105
           V+APGQE+GA     
Sbjct: 61  VDAPGQEDGAASFPG 75

This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3. Their similarity was previously noted. The precise molecular and cellular function of members of this family is still unknown. Yet, they are known to be involved in cellular differentiation events. The Ndr1 group was the first to be discovered. Their expression is repressed by the proto-oncogenes N-myc and c-myc, and in line with this observation, Ndr1 protein expression is down-regulated in neoplastic cells, and is reactivated when differentiation is induced by chemicals such as retinoic acid. Ndr2 and Ndr3 expression is not under the control of N-myc or c-myc. Ndr1 expression is also activated by several chemicals: tunicamycin and homocysteine induce Ndr1 in human umbilical endothelial cells; nickel induces Ndr1 in several cell types. Members of this family are found in wide variety of multicellular eukaryotes, including an Ndr1 type protein in Helianthus annuus (sunflower), known as Sf21. Interestingly, the highest scoring matches in the noise are all alpha/beta hydrolases pfam00561, suggesting that this family may have an enzymatic function (Bateman A pers. obs.). Length = 284

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
KOG2931|consensus 326 100.0
PF03096 283 Ndr: Ndr family; InterPro: IPR004142 This family c 100.0
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.09
PRK05855 582 short chain dehydrogenase; Validated 96.62
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 96.61
PRK00870 302 haloalkane dehalogenase; Provisional 96.46
PLN02824 294 hydrolase, alpha/beta fold family protein 96.08
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 96.07
PRK10673 255 acyl-CoA esterase; Provisional 95.99
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 95.75
PRK03204 286 haloalkane dehalogenase; Provisional 95.59
PLN02679 360 hydrolase, alpha/beta fold family protein 95.46
PRK03592 295 haloalkane dehalogenase; Provisional 95.43
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 95.03
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 94.84
PRK10349 256 carboxylesterase BioH; Provisional 94.64
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 94.59
PRK06489 360 hypothetical protein; Provisional 94.52
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 94.39
PLN02385 349 hydrolase; alpha/beta fold family protein 94.19
PRK05077 414 frsA fermentation/respiration switch protein; Revi 94.03
PLN02578 354 hydrolase 93.44
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 93.36
PLN02298 330 hydrolase, alpha/beta fold family protein 92.83
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 92.66
PLN02894 402 hydrolase, alpha/beta fold family protein 91.25
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 91.01
PRK07581 339 hypothetical protein; Validated 89.52
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 89.5
PRK10749 330 lysophospholipase L2; Provisional 88.67
PLN02211 273 methyl indole-3-acetate methyltransferase 88.33
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 88.1
PLN02872 395 triacylglycerol lipase 87.9
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 87.53
PRK08775 343 homoserine O-acetyltransferase; Provisional 86.95
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 86.53
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 86.47
PRK10162 318 acetyl esterase; Provisional 86.45
PHA02857 276 monoglyceride lipase; Provisional 84.55
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 84.22
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 83.13
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 82.81
PLN02511 388 hydrolase 82.42
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 80.71
>KOG2931|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-40  Score=270.02  Aligned_cols=97  Identities=47%  Similarity=0.739  Sum_probs=91.5

Q ss_pred             CCCCCccccceeeeccccccccccCCCCceeEEEecCCceEEEEEeCCCC--CCeEEEeccCCCcchhcccccccchhHH
Q psy10722          3 AESMDDVDLRQVQLSIPLTRSLARTDPTVEEVYVETDRGSILVAVAGNRG--KPAILTYHDLGLNYISNFQAFFNFSDMR   80 (106)
Q Consensus         3 ~~~m~dv~l~~~~~~~~~~r~~~~~~~~~qe~~V~T~~G~v~V~v~G~~~--kPailTyHDvGlNh~scF~~ff~~~~m~   80 (106)
                      |++++|++++++||++.+..       ..+||+|+|.+|.|||+|||+++  |||||||||+||||+||||+|||+|+|+
T Consensus         1 M~~~~~~~~~d~~pl~~~~~-------~~~e~~V~T~~G~v~V~V~Gd~~~~kpaiiTyhDlglN~~scFq~ff~~p~m~   73 (326)
T KOG2931|consen    1 MAELQDVVSTDIKPLLEGGA-------TCQEHDVETAHGVVHVTVYGDPKGNKPAIITYHDLGLNHKSCFQGFFNFPDMA   73 (326)
T ss_pred             CCcccccccccchhhhcCCC-------cceeeeeccccccEEEEEecCCCCCCceEEEecccccchHhHhHHhhcCHhHH
Confidence            57899999999999997762       26999999999999999999877  9999999999999999999999999999


Q ss_pred             HhhcCceEEEEcCCCCCCCCCCCCCC
Q psy10722         81 SLLENFSVYHVNAPGQEEGAQPLADE  106 (106)
Q Consensus        81 ei~~~f~i~HVdaPGqe~gA~~lp~~  106 (106)
                      ||++|||||||||||||+|||.||.|
T Consensus        74 ei~~~fcv~HV~~PGqe~gAp~~p~~   99 (326)
T KOG2931|consen   74 EILEHFCVYHVDAPGQEDGAPSFPEG   99 (326)
T ss_pred             HHHhheEEEecCCCccccCCccCCCC
Confidence            99999999999999999999999975

>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2xmr_A 281 Crystal Structure Of Human Ndrg2 Protein Provides I 4e-15
2xmq_A 281 Crystal Structure Of Human Ndrg2 Protein Provides I 5e-15
2xms_A 281 Crystal Structure Of Human Ndrg2 Protein Provides I 1e-14
2qmq_A 286 Crystal Structure Of A N-Myc Downstream Regulated 2 1e-14
>pdb|2XMR|A Chain A, Crystal Structure Of Human Ndrg2 Protein Provides Insight Into Its Role As A Tumor Suppressor Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 2/67 (2%)
Query: 36  VETDRGSILVAVAGNRG--KPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNA 93
           VET  GS+   V G     +PAILTYHD+GLNY S FQ  F F DM+ +++NF   HV+A
Sbjct: 6   VETPYGSVTFTVYGTPAPARPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDA 65
Query: 94  PGQEEGA 100
           PG EEGA
Sbjct: 66  PGMEEGA 72
>pdb|2XMQ|A Chain A, Crystal Structure Of Human Ndrg2 Protein Provides Insight Into Its Role As A Tumor Suppressor Length = 281 Back     alignment and structure
>pdb|2XMS|A Chain A, Crystal Structure Of Human Ndrg2 Protein Provides Insight Into Its Role As A Tumor Suppressor Length = 281 Back     alignment and structure
>pdb|2QMQ|A Chain A, Crystal Structure Of A N-Myc Downstream Regulated 2 Protein (Ndrg2, Syld, Ndr2, Ai182517, Au040374) From Mus Musculus At 1.70 A Resolution Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 2e-16
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
 Score = 71.3 bits (174), Expect = 2e-16
 Identities = 36/77 (46%), Positives = 44/77 (57%), Gaps = 2/77 (2%)

Query: 32  EEVYVETDRGSILVAVAGNR--GKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVY 89
               VET  GS+   V G     +PAI TYHD+GLNY S FQ  F F DM+ +++NF   
Sbjct: 12  HTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRV 71

Query: 90  HVNAPGQEEGAQPLADE 106
           HV+APG EEGA      
Sbjct: 72  HVDAPGMEEGAPVFPLG 88

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.11
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.97
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.91
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 97.82
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 97.69
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.59
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.49
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.36
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 97.35
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.34
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 97.31
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.29
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.26
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 97.24
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 97.22
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.22
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 97.17
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 97.15
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.11
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 97.08
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 97.08
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.07
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 97.05
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.03
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 96.97
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.91
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.9
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 96.9
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.87
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 96.83
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 96.81
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 96.76
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 96.76
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.72
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 96.71
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 96.68
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 96.68
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 96.62
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 96.56
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.54
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.5
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 96.48
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 96.47
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.43
1iup_A 282 META-cleavage product hydrolase; aromatic compound 96.37
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 96.36
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 95.3
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.27
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 96.22
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 96.19
3bdi_A 207 Uncharacterized protein TA0194; NP_393672.1, predi 96.19
3trd_A 208 Alpha/beta hydrolase; cellular processes; 1.50A {C 96.16
1imj_A 210 CIB, CCG1-interacting factor B; alpha/beta hydrola 96.14
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.13
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 96.1
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.07
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 96.06
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.03
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.97
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 95.94
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 95.91
2o2g_A 223 Dienelactone hydrolase; YP_324580.1, structural ge 95.87
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 95.84
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 95.81
2fuk_A 220 XC6422 protein; A/B hydrolase, structural genomics 95.76
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 95.63
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.63
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 95.61
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 95.56
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 95.55
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 95.51
1r3d_A 264 Conserved hypothetical protein VC1974; structural 95.38
3h04_A 275 Uncharacterized protein; protein with unknown func 95.24
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 95.21
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 95.18
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 95.13
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 95.07
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 95.0
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.97
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 94.95
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 94.87
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 94.87
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 94.71
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.7
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 94.68
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 94.65
3llc_A 270 Putative hydrolase; structural genomics, joint cen 94.58
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 94.53
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 94.45
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 94.36
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 94.32
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 94.3
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 94.22
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 94.21
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 94.2
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.06
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 93.9
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 93.89
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 93.83
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 93.75
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 93.56
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.38
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 93.31
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 93.23
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 93.1
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 93.02
2h1i_A 226 Carboxylesterase; structural genomics, PSI-2, prot 92.72
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 92.7
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 92.6
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 92.55
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 92.53
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 92.5
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 92.38
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 92.34
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 91.65
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 91.14
3cn9_A 226 Carboxylesterase; alpha/beta hydrolase fold super- 91.04
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 90.55
2r8b_A 251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 90.34
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 90.26
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 89.69
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 89.45
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 88.64
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 88.53
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 88.07
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 87.97
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 87.91
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 87.85
3b5e_A 223 MLL8374 protein; NP_108484.1, carboxylesterase, st 87.57
1auo_A 218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 87.4
4ao6_A 259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 87.37
2qs9_A 194 Retinoblastoma-binding protein 9; B5T overexpresse 86.9
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 86.88
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 86.62
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 86.45
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 86.23
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 85.65
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 85.17
1isp_A 181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 85.02
3og9_A 209 Protein YAHD A copper inducible hydrolase; alpha/b 84.71
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 84.02
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 83.81
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 83.06
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 82.94
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 81.99
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 81.82
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 81.19
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 81.03
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 80.02
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
Probab=98.11  E-value=1.2e-05  Score=57.07  Aligned_cols=69  Identities=52%  Similarity=0.847  Sum_probs=55.2

Q ss_pred             EEEecCCceEEEEEeCCC--CCCeEEEeccCCCcchhcccccccchhHHHhhcCceEEEEcCCCCCCCCCC
Q psy10722         34 VYVETDRGSILVAVAGNR--GKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEGAQP  102 (106)
Q Consensus        34 ~~V~T~~G~v~V~v~G~~--~kPailTyHDvGlNh~scF~~ff~~~~m~ei~~~f~i~HVdaPGqe~gA~~  102 (106)
                      +.+++....+++..+|++  ++|+||.+|..|.+..++|..+|..+-++.+.++|.++-+|.||+..+...
T Consensus        14 ~~~~~~~~~l~y~~~G~~~~~~p~vvllHG~~~~~~~~~~~~~~~~~~~~L~~~~~vi~~D~~G~G~s~~~   84 (286)
T 2qmq_A           14 HSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPV   84 (286)
T ss_dssp             EEEEETTEEEEEEEESCCCTTCCEEEEECCTTCCHHHHHHHHHTSHHHHHHHTTSCEEEEECTTTSTTCCC
T ss_pred             cccccCCeEEEEEeccCCCCCCCeEEEeCCCCCCchhhhhhhhhhchhHHHhcCCCEEEecCCCCCCCCCC
Confidence            344445568999999975  789999999999998777777666556788888899999999999765543
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 106
d1c4xa_ 281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 2e-05
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)
species: Rhodococcus sp., strain rha1 [TaxId: 1831]

 Score = 39.1 bits (89), Expect = 2e-05
 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 7/70 (10%)

Query: 30 TVE--EVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSD-MRSLLENF 86
          TVE  E    +   +    VAG+   PA++  H  G        A  N+   +  L ENF
Sbjct: 1  TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAG----PGAHAASNWRPIIPDLAENF 56

Query: 87 SVYHVNAPGQ 96
           V   +  G 
Sbjct: 57 FVVAPDLIGF 66

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.36
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.1
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 97.93
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.87
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.69
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 97.55
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.49
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.48
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 97.32
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.31
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.18
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 97.13
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 96.97
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 96.97
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 96.95
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.9
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 96.84
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 96.83
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 96.71
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 96.69
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 96.05
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.98
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 95.95
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.52
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 95.46
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 95.1
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 94.71
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 94.66
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 94.37
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.36
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 94.07
d1imja_ 208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 93.5
d2h1ia1 202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 90.41
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 90.34
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 90.0
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 88.99
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 88.69
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 88.3
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 88.03
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 87.7
d3b5ea1 209 Uncharacterized protein Mll8374 {Mesorhizobium lot 86.13
d2r8ba1 203 Uncharacterized protein Atu2452 {Agrobacterium tum 83.76
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 82.01
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)
species: Rhodococcus sp., strain rha1 [TaxId: 1831]

Probab=98.36  E-value=9.7e-07  Score=60.42  Aligned_cols=66  Identities=21%  Similarity=0.217  Sum_probs=53.0

Q ss_pred             ceeEEEecCCceEEEEEeCCCCCCeEEEeccCCCcchhcccccccchhHHHhhcCceEEEEcCCCCCCC
Q psy10722         31 VEEVYVETDRGSILVAVAGNRGKPAILTYHDLGLNYISNFQAFFNFSDMRSLLENFSVYHVNAPGQEEG   99 (106)
Q Consensus        31 ~qe~~V~T~~G~v~V~v~G~~~kPailTyHDvGlNh~scF~~ff~~~~m~ei~~~f~i~HVdaPGqe~g   99 (106)
                      +-|+.+++....+|+.+.|++++|+||..|..|.+..+. ..|  .+-++.+.++|.+|-+|.||+..-
T Consensus         4 ~~~~~~~~~~~~~h~~~~G~~~~p~ivllHG~~~~~~~~-~~~--~~~~~~L~~~~~vi~~D~~G~G~S   69 (281)
T d1c4xa_           4 IIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAA-SNW--RPIIPDLAENFFVVAPDLIGFGQS   69 (281)
T ss_dssp             CEEEEECCTTSCEEEEEESCTTSCEEEEECCCSTTCCHH-HHH--GGGHHHHHTTSEEEEECCTTSTTS
T ss_pred             EEEEEEccCCEEEEEEEEecCCCCEEEEECCCCCCCcHH-HHH--HHHHHHHhCCCEEEEEeCCCCccc
Confidence            457888888889999999999999999999998876442 112  233677888999999999999654
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure