Diaphorina citri psyllid: psy10725


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MISRAAQKELVGRSLCTPAIEDYEVDLYLRQKWQDQRLKHHSITKTLDLNDPNLVKAIWKPEVYFPNAKHAEFQYVTVPNVLVRINPDGEILYMLSIIENNTNKRKQKRKALDLNDPNLVKAIWKPEVYFPNAKHAEFQYVTVPNVLVRINPDGEILYML
cccccccEEEEECcccccccCEEEEEEEEEcEECccccccccccccCCccccHHccccccccccEEcccCEEEEEcccccEEEEEcccccEEEEEEEEEEccccccccccccccccccHHHccccccccCCcccCEEEEEEECccCEEEEcccccEEEEc
******QKELVGRSLCTPAIEDYEVDLYLRQKWQDQRLKHHSITKTLDLNDPNLVKAIWKPEVYFPNAKHAEFQYVTVPNVLVRINPDGEILYMLSIIENNTNKRKQKRKALDLNDPNLVKAIWKPEVYFPNAKHAEFQYVTVPNVLVRINPDGEILYML
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISRAAQKELVGRSLCTPAIEDYEVDLYLRQKWQDQRLKHHSITKTLDLNDPNLVKAIWKPEVYFPNAKHAEFQYVTVPNVLVRINPDGEILYMLSIIENNTNKRKQKRKALDLNDPNLVKAIWKPEVYFPNAKHAEFQYVTVPNVLVRINPDGEILYML

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004890 [MF]GABA-A receptor activityprobableGO:0038023, GO:0016917, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0016933 [MF]extracellular-glycine-gated ion channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005230, GO:0005231, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022803, GO:0022839, GO:0022838, GO:0005216
GO:0051932 [BP]synaptic transmission, GABAergicprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0007267, GO:0044763, GO:0023052, GO:0007268, GO:0007270, GO:0007154, GO:0044699, GO:0003008
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0043235 [CC]receptor complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0007218 [BP]neuropeptide signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0005254 [MF]chloride channel activityprobableGO:0022891, GO:0022838, GO:0005215, GO:0008509, GO:0015108, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0015103, GO:0022892, GO:0022803, GO:0005253, GO:0005216
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RHW, chain A
Confidence level:very confident
Coverage over the Query: 7-126
View the alignment between query and template
View the model in PyMOL
Template: 3RHW, chain A
Confidence level:very confident
Coverage over the Query: 88-159
View the alignment between query and template
View the model in PyMOL