Diaphorina citri psyllid: psy10729


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIEFNPQPVNTVNGFNF
cHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIE***********VN****FNF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIEFNPQPVNTVNGFNF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Importin subunit alpha-3 Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. Recognizes NLSs of influenza A virus nucleoprotein probably through ARM repeats 7-9.confidentO00505
Importin subunit alpha-3 Essential gene for embryonic and larval development. Required for oogenic development, ima-1 and ima-2 cannot functionally compensate for loss of ima-3.confidentQ19969
Importin subunit alpha-B Functions in nuclear protein import via a substrate-importin alpha-beta transport complex that passes though the nuclear pore complexes (NPC). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif.confidentQ76P29

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0008565 [MF]protein transporter activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0022402 [BP]cell cycle processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0006607 [BP]NLS-bearing substrate import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0051641, GO:0017038, GO:0034613, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000176 [CC]nuclear exosome (RNase complex)probableGO:0043234, GO:0005575, GO:0000178, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JDQ, chain A
Confidence level:very confident
Coverage over the Query: 2-337
View the alignment between query and template
View the model in PyMOL
Template: 3TPO, chain A
Confidence level:very confident
Coverage over the Query: 2-334
View the alignment between query and template
View the model in PyMOL