Psyllid ID: psy10729


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIEFNPQPVNTVNGFNF
cHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
cHHHHHHHHHHHHcccccccHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
MRMIATRSARKMlskerhppidelieagVVPICVEllddenpntqfEATWAltniasgtseqTMTVINANAIPKFLQLlssphlnlAEQATWALGNIAGDGARARDLLLglgtmpqilalvqpntpttfLRNIVWAISNLcrnknpapdfekiKICLPLLNQLIHTTDVETLSDICWALSyisdghndkiqAVVDTGVVPRLVELLDSEETTILTAALRTvgniatgndhqtdcVIQAGGLQKMKKLLSSSRVNIVKEAAWTIsnitagnsrqIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFndsaensiengdtiefnpqpvntvngfnf
mrmiatrsarkmlskerhppidelIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTisnitagnsrQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGdtiefnpqpvntvngfnf
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIagdgarardlllglgTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIEFNPQPVNTVNGFNF
*********************DELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFN****************************
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIE***********VN****FNF
**************KERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIEFNPQPVNTVNGFNF
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFND***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIEFNPQPVNTVNGFNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query363 2.2.26 [Sep-21-2011]
P52295522 Importin subunit alpha OS yes N/A 0.997 0.693 0.446 4e-91
P52170522 Importin subunit alpha-1 N/A N/A 0.942 0.655 0.438 2e-88
O35343521 Importin subunit alpha-4 yes N/A 0.991 0.690 0.422 5e-88
O00505521 Importin subunit alpha-3 yes N/A 1.0 0.696 0.413 6e-88
O35344521 Importin subunit alpha-3 no N/A 1.0 0.696 0.413 7e-88
O00629521 Importin subunit alpha-4 no N/A 0.988 0.689 0.416 2e-87
P52171523 Importin subunit alpha-2 N/A N/A 0.911 0.632 0.447 3e-87
Q96321532 Importin subunit alpha-1 yes N/A 0.994 0.678 0.412 2e-83
P52292529 Importin subunit alpha-2 no N/A 0.964 0.661 0.417 1e-81
Q9SLX0534 Importin subunit alpha-1b yes N/A 0.972 0.661 0.399 1e-81
>sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster GN=Pen PE=1 SV=2 Back     alignment and function desciption
 Score =  335 bits (859), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 195/437 (44%), Positives = 254/437 (58%), Gaps = 75/437 (17%)

Query: 2   RMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNT-QFEATWALTNIASGTS 60
           + +  +SARKMLS+ER+PPID +I  G+VPIC+  L + N +  QFEA WALTNIASGTS
Sbjct: 86  QFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFLQNTNNSMLQFEAAWALTNIASGTS 145

Query: 61  EQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILAL 120
           +QT  VI  NA+P F+ LL S  +NLAEQA WALGNIAGDGA ARD+++    +  IL L
Sbjct: 146 DQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHHNVIDGILPL 205

Query: 121 VQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALS 180
           +   TP +FLRNIVW +SNLCRNKNP+P F+++K  LP+L+QL+ + D++ L+D CWALS
Sbjct: 206 INNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADACWALS 265

Query: 181 YISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTD------- 233
           Y++D  N KIQAVVD+  VPRLV+LL  +E +I+  ALR+VGNI TG D QTD       
Sbjct: 266 YVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGG 325

Query: 234 -----------------------------------CVIQAGGLQKMKKLLSSSRVNIVKE 258
                                               VIQAG  Q+++ +L        KE
Sbjct: 326 LPRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKE 385

Query: 259 AAWTISNIT-AGNSRQID------------------------HVIQEGLDNLLEIALQVG 293
           AAW ++N T +G   QI                          V+Q GL NL  +A ++G
Sbjct: 386 AAWAVTNTTTSGTPEQIVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLFALAEKLG 445

Query: 294 ELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAF---NDSAENSI---ENGDT 347
               + L+VEE GGL+KLE LQ HENE VY+K Y II   F   +D AE  +   E    
Sbjct: 446 GTENLCLMVEEMGGLDKLETLQQHENEEVYKKAYAIIDTYFSNGDDEAEQELAPQEVNGA 505

Query: 348 IEFNP-QPVNTVNGFNF 363
           +EFN  QP     G+ F
Sbjct: 506 LEFNATQPKAPEGGYTF 522




It is required for normal cell proliferation and may serve as an adapter molecule to form complexes with other proteins. May act as a tumor suppressor in hematopoietic cells. May play a role in the nuclear import of karyophilic proteins and some of these may be required for the normal transmission and function of proliferative signals in the cells.
Drosophila melanogaster (taxid: 7227)
>sp|P52170|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis GN=kpna1 PE=1 SV=2 Back     alignment and function description
>sp|O35343|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna4 PE=2 SV=1 Back     alignment and function description
>sp|O00505|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 Back     alignment and function description
>sp|O35344|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus GN=Kpna3 PE=1 SV=1 Back     alignment and function description
>sp|O00629|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA4 PE=1 SV=1 Back     alignment and function description
>sp|P52171|IMA2_XENLA Importin subunit alpha-2 OS=Xenopus laevis GN=kpna2 PE=1 SV=2 Back     alignment and function description
>sp|Q96321|IMA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=KAP1 PE=1 SV=2 Back     alignment and function description
>sp|P52292|IMA2_HUMAN Importin subunit alpha-2 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
322796155425 hypothetical protein SINV_05723 [Solenop 0.922 0.788 0.560 1e-107
345488160 520 PREDICTED: importin subunit alpha-2-like 0.988 0.690 0.484 1e-103
307199037 517 Importin subunit alpha-2 [Harpegnathos s 0.997 0.700 0.456 1e-100
350396236 519 PREDICTED: importin subunit alpha-2-like 0.994 0.695 0.475 1e-100
91077394 516 PREDICTED: similar to importin alpha 1a 0.961 0.676 0.469 3e-99
340722259 519 PREDICTED: importin subunit alpha-2-like 0.994 0.695 0.464 1e-98
195116553 522 GI17589 [Drosophila mojavensis] gi|19391 0.997 0.693 0.462 3e-98
383858926 518 PREDICTED: importin subunit alpha-2-like 0.925 0.648 0.503 1e-97
332024026 477 Importin subunit alpha-2 [Acromyrmex ech 0.922 0.702 0.475 2e-97
380029460 520 PREDICTED: importin subunit alpha-2-like 0.997 0.696 0.486 3e-97
>gi|322796155|gb|EFZ18731.1| hypothetical protein SINV_05723 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  395 bits (1015), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 252/337 (74%), Gaps = 2/337 (0%)

Query: 1   MRMIATRSARKMLSKERHPPIDELIEAGVVPICVELLD-DENPNTQFEATWALTNIASGT 59
           +++ A ++ RK+LS+ER PPI+++IE G+VP+C++ LD D+N + QFE TW LTNIASGT
Sbjct: 87  LQLTAIQTCRKLLSRERDPPINDMIEGGIVPLCIKFLDNDDNISLQFEVTWVLTNIASGT 146

Query: 60  SEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILA 119
           S QT  V+   A+PK ++LL S    +AEQA WALGNIAGDG  ARDL+LG   +P+++ 
Sbjct: 147 SVQTQNVVKHGAVPKLVKLLQSASPMVAEQAVWALGNIAGDGPYARDLVLGHDALPRLVD 206

Query: 120 LVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWAL 179
           L++P+TP TF RNIVW +SNLCRNKNP+P FE I+  LP+ N+L+  TD + L+D CWAL
Sbjct: 207 LIKPDTPMTFTRNIVWTLSNLCRNKNPSPSFELIRPLLPVFNRLLSYTDRDVLADTCWAL 266

Query: 180 SYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAG 239
           SY++DG NDKIQAV++TG++P+LVELL S E  ILT ALR VGNI TGND QTD VI AG
Sbjct: 267 SYLTDGTNDKIQAVLETGIIPKLVELLASREGAILTPALRAVGNIVTGNDAQTDAVISAG 326

Query: 240 GLQKMKKLLSSSRVNIVKEAAWTISNITA-GNSRQIDHVIQEGLDNLLEIALQVGELNQM 298
           GL     LL   R NIVKEAAW +SNITA      I  V+ +GL N+L  A +VG+++++
Sbjct: 327 GLSHFGALLRYPRANIVKEAAWAVSNITAESKDWNIILVVLDGLTNILHAAEKVGQVDKL 386

Query: 299 ALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFN 335
           A+++E+ GGL+K+EALQ+HENE VYQ+   II   F+
Sbjct: 387 AIMIEQVGGLDKIEALQNHENEEVYQRSMAIIDAFFS 423




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345488160|ref|XP_001605009.2| PREDICTED: importin subunit alpha-2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307199037|gb|EFN79761.1| Importin subunit alpha-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350396236|ref|XP_003484488.1| PREDICTED: importin subunit alpha-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|91077394|ref|XP_975293.1| PREDICTED: similar to importin alpha 1a [Tribolium castaneum] gi|270001645|gb|EEZ98092.1| hypothetical protein TcasGA2_TC000505 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340722259|ref|XP_003399525.1| PREDICTED: importin subunit alpha-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195116553|ref|XP_002002818.1| GI17589 [Drosophila mojavensis] gi|193913393|gb|EDW12260.1| GI17589 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|383858926|ref|XP_003704950.1| PREDICTED: importin subunit alpha-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332024026|gb|EGI64244.1| Importin subunit alpha-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380029460|ref|XP_003698390.1| PREDICTED: importin subunit alpha-2-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
FB|FBgn0011823522 Pen "Pendulin" [Drosophila mel 0.807 0.561 0.544 2.6e-98
ZFIN|ZDB-GENE-030131-5584531 kpna4 "karyopherin alpha 4 (im 0.809 0.553 0.491 1.3e-86
MGI|MGI:1100848521 Kpna4 "karyopherin (importin) 0.809 0.564 0.488 1.3e-86
RGD|1311483521 Kpna4 "karyopherin alpha 4 (im 0.809 0.564 0.488 1.3e-86
UNIPROTKB|C1JZ67521 KPNA4 "Importin subunit alpha" 0.809 0.564 0.488 1.7e-86
UNIPROTKB|E2RPB3521 KPNA4 "Importin subunit alpha" 0.809 0.564 0.488 1.7e-86
UNIPROTKB|J9PAW2521 KPNA4 "Importin subunit alpha" 0.809 0.564 0.488 1.7e-86
UNIPROTKB|Q5ZLF7521 KPNA4 "Importin subunit alpha" 0.809 0.564 0.488 2.1e-86
ZFIN|ZDB-GENE-040718-22546 kpna2 "karyopherin alpha 2 (RA 0.798 0.531 0.508 3.5e-86
UNIPROTKB|F1NV68486 KPNA3 "Importin subunit alpha" 0.776 0.580 0.505 4.4e-86
FB|FBgn0011823 Pen "Pendulin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 817 (292.7 bits), Expect = 2.6e-98, Sum P(2) = 2.6e-98
 Identities = 160/294 (54%), Positives = 207/294 (70%)

Query:     2 RMIATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNT-QFEATWALTNIASGTS 60
             + +  +SARKMLS+ER+PPID +I  G+VPIC+  L + N +  QFEA WALTNIASGTS
Sbjct:    86 QFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFLQNTNNSMLQFEAAWALTNIASGTS 145

Query:    61 EQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIXXXXXXXXXXXXXXXTMPQILAL 120
             +QT  VI  NA+P F+ LL S  +NLAEQA WALGNI                +  IL L
Sbjct:   146 DQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHHNVIDGILPL 205

Query:   121 VQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALS 180
             +   TP +FLRNIVW +SNLCRNKNP+P F+++K  LP+L+QL+ + D++ L+D CWALS
Sbjct:   206 INNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADACWALS 265

Query:   181 YISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGG 240
             Y++D  N KIQAVVD+  VPRLV+LL  +E +I+  ALR+VGNI TG D QTD VI +GG
Sbjct:   266 YVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGG 325

Query:   241 LQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGE 294
             L ++  LL  ++ NIVKEAAWT+SNITAGN +QI  VIQ G+   L   L+ G+
Sbjct:   326 LPRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGD 379


GO:0048542 "lymph gland development" evidence=IMP
GO:0005737 "cytoplasm" evidence=NAS;IDA
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0007303 "cytoplasmic transport, nurse cell to oocyte" evidence=NAS
GO:0015629 "actin cytoskeleton" evidence=NAS
GO:0016482 "cytoplasmic transport" evidence=IMP
GO:0008320 "protein transmembrane transporter activity" evidence=NAS
GO:0005643 "nuclear pore" evidence=NAS
GO:0006606 "protein import into nucleus" evidence=IEA;NAS
GO:0000059 "protein import into nucleus, docking" evidence=NAS
GO:0008283 "cell proliferation" evidence=NAS
GO:0006607 "NLS-bearing substrate import into nucleus" evidence=NAS
GO:0007291 "sperm individualization" evidence=IMP
GO:0007301 "female germline ring canal formation" evidence=IMP
GO:0042332 "gravitaxis" evidence=IMP
GO:0008565 "protein transporter activity" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0051298 "centrosome duplication" evidence=IMP
ZFIN|ZDB-GENE-030131-5584 kpna4 "karyopherin alpha 4 (importin alpha 3)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1100848 Kpna4 "karyopherin (importin) alpha 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311483 Kpna4 "karyopherin alpha 4 (importin alpha 3)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|C1JZ67 KPNA4 "Importin subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPB3 KPNA4 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAW2 KPNA4 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLF7 KPNA4 "Importin subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-22 kpna2 "karyopherin alpha 2 (RAG cohort 1, importin alpha 1)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV68 KPNA3 "Importin subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52295IMA_DROMENo assigned EC number0.44620.99720.6934yesN/A
O35343IMA4_MOUSENo assigned EC number0.42230.99170.6909yesN/A
O00505IMA3_HUMANNo assigned EC number0.41371.00.6967yesN/A
Q02821IMA1_YEASTNo assigned EC number0.41050.97520.6531yesN/A
Q96321IMA1_ARATHNo assigned EC number0.41250.99440.6785yesN/A
O94374IMA2_SCHPONo assigned EC number0.51230.77680.5231yesN/A
Q19969IMA3_CAEELNo assigned EC number0.39950.99170.7003yesN/A
Q76P29IMAB_DICDINo assigned EC number0.50540.75200.5290yesN/A
Q9SLX0IMA1B_ORYSJNo assigned EC number0.39900.97240.6610yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-108
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-29
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-28
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 5e-20
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-18
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 1e-09
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 5e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 6e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 2e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 3e-07
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 4e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 9e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 2e-06
pfam1364688 pfam13646, HEAT_2, HEAT repeats 7e-05
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 8e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.001
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.002
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
 Score =  325 bits (835), Expect = e-108
 Identities = 154/293 (52%), Positives = 192/293 (65%), Gaps = 2/293 (0%)

Query: 5   ATRSARKMLSKERHPPIDELIEAGVVPICVELLDDENPNT-QFEATWALTNIASGTSEQT 63
           A    RK+LSKE  PPI  +I+AGVVP  VE +D+   +  QFEA WALTNIASGT++QT
Sbjct: 91  AVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFMDEIQRDMLQFEAAWALTNIASGTTQQT 150

Query: 64  MTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQP 123
             V++A A+P F+QLLSS   ++ EQA WALGNIAGD    RD +L  G +  +L L+  
Sbjct: 151 KVVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLLS 210

Query: 124 NTPT-TFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYI 182
           +    + LRN  W +SNLCR KNP PD+  I   LP+L +LI++ D E L D CWA+SY+
Sbjct: 211 SAIHISMLRNATWTLSNLCRGKNPPPDWSNISQALPILAKLIYSRDPEVLVDACWAISYL 270

Query: 183 SDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQ 242
           SDG N+KIQAV+D G+  RLVELL  E   I T ALR+VGNI TG+D QT  +I  G L+
Sbjct: 271 SDGPNEKIQAVLDVGIPGRLVELLSHESAKIQTPALRSVGNIVTGSDDQTQVIINCGALK 330

Query: 243 KMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGEL 295
             + LLSS + NI KEA WTISNITAGN+ QI  VI   L   L   L   E 
Sbjct: 331 AFRSLLSSPKENIRKEACWTISNITAGNTEQIQAVIDANLIPPLIHLLSSAEY 383


Length = 526

>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 363
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224|consensus550 99.97
KOG4224|consensus550 99.96
PF05804708 KAP: Kinesin-associated protein (KAP) 99.91
KOG4199|consensus461 99.83
KOG1048|consensus717 99.76
PF05804708 KAP: Kinesin-associated protein (KAP) 99.75
KOG2122|consensus 2195 99.7
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.68
KOG4199|consensus461 99.65
PRK09687280 putative lyase; Provisional 99.63
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.63
KOG2122|consensus 2195 99.63
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.57
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.57
KOG1048|consensus717 99.57
KOG0168|consensus 1051 99.56
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.55
KOG1222|consensus791 99.54
KOG4500|consensus604 99.52
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.46
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.4
PRK09687280 putative lyase; Provisional 99.32
KOG2160|consensus342 99.31
KOG1517|consensus 1387 99.31
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.28
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.27
KOG2160|consensus342 99.26
KOG2171|consensus 1075 99.24
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.21
KOG4500|consensus604 99.21
KOG2759|consensus442 99.18
KOG2023|consensus 885 99.18
KOG1293|consensus 678 99.18
KOG1241|consensus 859 99.17
KOG2171|consensus 1075 99.15
KOG0168|consensus 1051 99.13
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.13
KOG1222|consensus 791 99.1
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.1
PTZ00429 746 beta-adaptin; Provisional 99.1
KOG2759|consensus442 99.07
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.06
KOG3678|consensus 832 98.99
KOG1293|consensus 678 98.97
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.96
KOG1059|consensus 877 98.93
KOG2023|consensus 885 98.9
KOG0946|consensus 970 98.87
KOG1517|consensus 1387 98.85
PTZ00429 746 beta-adaptin; Provisional 98.81
KOG0946|consensus 970 98.81
KOG2973|consensus353 98.74
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.73
COG5369743 Uncharacterized conserved protein [Function unknow 98.72
KOG3678|consensus 832 98.7
KOG4646|consensus173 98.69
KOG1062|consensus 866 98.67
KOG1242|consensus 569 98.6
COG5369743 Uncharacterized conserved protein [Function unknow 98.57
KOG0213|consensus1172 98.57
KOG1241|consensus 859 98.55
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.53
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.49
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.45
KOG4646|consensus173 98.42
KOG1062|consensus 866 98.4
KOG1824|consensus 1233 98.4
KOG1061|consensus 734 98.37
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.37
KOG1824|consensus1233 98.3
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 98.29
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.25
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.25
KOG1789|consensus 2235 98.24
KOG0212|consensus 675 98.24
KOG2973|consensus353 98.22
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.21
TIGR02270410 conserved hypothetical protein. Members are found 98.19
KOG0213|consensus1172 98.14
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.13
PF05536 543 Neurochondrin: Neurochondrin 98.13
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.12
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.12
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.11
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.11
PF05536 543 Neurochondrin: Neurochondrin 98.11
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.08
KOG1789|consensus 2235 98.07
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.07
KOG0212|consensus 675 98.03
KOG2259|consensus 823 98.01
KOG1242|consensus569 98.0
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.98
KOG2734|consensus536 97.96
KOG4413|consensus524 97.96
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 97.92
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.91
KOG1059|consensus 877 97.9
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.89
KOG4413|consensus524 97.88
KOG1060|consensus 968 97.87
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.86
KOG4151|consensus748 97.83
KOG1240|consensus 1431 97.83
KOG2259|consensus 823 97.79
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.74
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.73
KOG1061|consensus 734 97.72
TIGR02270410 conserved hypothetical protein. Members are found 97.69
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.69
KOG1248|consensus 1176 97.69
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.68
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.66
KOG1240|consensus 1431 97.66
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.64
KOG2062|consensus 929 97.64
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.63
KOG0567|consensus289 97.61
KOG1058|consensus 948 97.6
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 97.6
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.59
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.51
KOG0915|consensus 1702 97.5
KOG1943|consensus 1133 97.5
KOG1248|consensus 1176 97.47
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.46
KOG1967|consensus1030 97.46
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 97.42
KOG2734|consensus536 97.42
KOG0414|consensus 1251 97.41
KOG1077|consensus 938 97.38
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.38
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.35
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.34
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.33
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.32
KOG2274|consensus 1005 97.3
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 97.25
KOG1077|consensus 938 97.14
KOG1060|consensus 968 97.13
KOG0211|consensus 759 97.09
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.01
KOG2032|consensus533 96.99
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.97
KOG0211|consensus759 96.95
KOG4151|consensus748 96.95
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.94
KOG4653|consensus982 96.91
KOG4535|consensus 728 96.89
KOG0915|consensus 1702 96.88
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.87
KOG3036|consensus293 96.86
PF05004309 IFRD: Interferon-related developmental regulator ( 96.85
KOG2956|consensus516 96.84
KOG1078|consensus 865 96.83
KOG0567|consensus289 96.8
KOG4653|consensus982 96.8
KOG1943|consensus 1133 96.8
KOG1078|consensus 865 96.72
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.72
KOG0414|consensus1251 96.68
KOG3036|consensus293 96.64
KOG1566|consensus342 96.63
KOG2274|consensus 1005 96.62
KOG1991|consensus 1010 96.59
PF11701157 UNC45-central: Myosin-binding striated muscle asse 96.58
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.54
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.53
PF05004309 IFRD: Interferon-related developmental regulator ( 96.46
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.43
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 96.4
KOG2025|consensus 892 96.39
KOG1058|consensus 948 96.36
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.33
KOG2956|consensus516 96.31
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 96.24
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.21
KOG4535|consensus728 96.19
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 96.18
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.17
COG50981128 Chromosome condensation complex Condensin, subunit 96.15
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 96.14
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 96.04
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.99
KOG1020|consensus 1692 95.95
KOG1967|consensus1030 95.93
KOG1991|consensus 1010 95.91
KOG1243|consensus 690 95.9
COG5116 926 RPN2 26S proteasome regulatory complex component [ 95.81
KOG1820|consensus 815 95.79
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.76
KOG2611|consensus 698 95.74
KOG1243|consensus690 95.71
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.69
PF13251182 DUF4042: Domain of unknown function (DUF4042) 95.65
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.61
KOG2025|consensus 892 95.6
KOG1820|consensus 815 95.59
KOG2062|consensus929 95.59
KOG3665|consensus699 95.34
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.27
KOG1949|consensus 1005 95.13
KOG3665|consensus699 95.12
COG5116926 RPN2 26S proteasome regulatory complex component [ 94.96
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 94.94
KOG2032|consensus533 94.79
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 94.66
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.66
COG50981128 Chromosome condensation complex Condensin, subunit 94.38
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 94.35
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 94.3
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 94.29
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 94.27
PF14500262 MMS19_N: Dos2-interacting transcription regulator 94.13
KOG2999|consensus 713 94.04
PRK14707 2710 hypothetical protein; Provisional 93.93
PF08167165 RIX1: rRNA processing/ribosome biogenesis 93.83
KOG2999|consensus 713 93.82
COG5656 970 SXM1 Importin, protein involved in nuclear import 93.71
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 93.63
KOG2137|consensus700 93.55
COG5656 970 SXM1 Importin, protein involved in nuclear import 93.49
PRK14707 2710 hypothetical protein; Provisional 93.25
PF11701157 UNC45-central: Myosin-binding striated muscle asse 93.23
PF08167165 RIX1: rRNA processing/ribosome biogenesis 92.9
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.87
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 92.87
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 92.77
KOG1020|consensus 1692 92.68
KOG2933|consensus334 92.43
KOG1832|consensus 1516 92.33
PF13251182 DUF4042: Domain of unknown function (DUF4042) 92.32
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 92.25
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 92.07
PF1036392 DUF2435: Protein of unknown function (DUF2435) 91.88
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 91.45
COG5209315 RCD1 Uncharacterized protein involved in cell diff 91.32
KOG2137|consensus 700 91.28
KOG1949|consensus 1005 91.18
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 90.72
KOG2933|consensus334 90.63
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 90.26
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 90.24
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 90.05
KOG0413|consensus 1529 90.01
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 90.0
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 89.47
PF12463303 DUF3689: Protein of unknown function (DUF3689) ; I 89.23
KOG0413|consensus 1529 89.07
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 88.9
PF0406458 DUF384: Domain of unknown function (DUF384); Inter 88.8
KOG2611|consensus 698 88.06
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 87.82
KOG1566|consensus342 87.69
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 87.6
cd03561133 VHS VHS domain family; The VHS domain is present i 87.59
COG5209315 RCD1 Uncharacterized protein involved in cell diff 87.58
smart00638574 LPD_N Lipoprotein N-terminal Domain. 87.36
KOG1848|consensus 1610 86.63
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 86.57
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 86.49
KOG1788|consensus 2799 86.38
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 86.16
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 85.96
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 85.95
PF14500262 MMS19_N: Dos2-interacting transcription regulator 84.94
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 84.58
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 84.56
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 84.51
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 84.34
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 84.12
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 83.94
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 83.87
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 82.78
cd03561133 VHS VHS domain family; The VHS domain is present i 82.62
PF12726727 SEN1_N: SEN1 N terminal; InterPro: IPR024481 The y 82.55
PF11229 589 DUF3028: Protein of unknown function (DUF3028); In 82.49
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 82.27
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 82.23
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 82.23
smart00638574 LPD_N Lipoprotein N-terminal Domain. 82.13
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 82.0
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 82.0
KOG2038|consensus 988 81.99
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 81.85
PF1472698 RTTN_N: Rotatin, an armadillo repeat protein, cent 81.34
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 81.24
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 80.06
PF1472698 RTTN_N: Rotatin, an armadillo repeat protein, cent 80.03
>KOG0166|consensus Back     alignment and domain information
Probab=100.00  E-value=3.3e-56  Score=395.58  Aligned_cols=360  Identities=53%  Similarity=0.881  Sum_probs=337.4

Q ss_pred             hhHHHHHHHHhhcCCCCCcHHHHHHcCCHHHHHHhcC-CCChhHHHHHHHHHHHhcCCChHhHHHHHhCCChHHHHHhcC
Q psy10729          2 RMIATRSARKMLSKERHPPIDELIEAGVVPICVELLD-DENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLS   80 (363)
Q Consensus         2 q~~a~~~l~~~l~~~~~~~~~~~~~~g~l~~L~~lL~-~~~~~i~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~l~~ll~   80 (363)
                      |+.|+.++|++++.+.+++++.++..|++|.+++.|. ..++.++..|+|+|.|+++++.+....+++.|++|.|+.++.
T Consensus        83 q~~a~~~~rkllS~~~~ppi~~vi~~G~v~~lV~~l~~~~~~~lq~eAAWaLTnIAsgtse~T~~vv~agavp~fi~Ll~  162 (514)
T KOG0166|consen   83 QLTATQAFRKLLSKERNPPIDEVIQSGVVPRLVEFLSRDDNPTLQFEAAWALTNIASGTSEQTKVVVDAGAVPIFIQLLS  162 (514)
T ss_pred             HHHHHHHHHHHHccCCCCCHHHHHHcCcHHHHHHHHccCCChhHHHHHHHHHHHHhcCchhhccccccCCchHHHHHHhc
Confidence            7889999999999999999999999999999999994 667999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHhhCCCCchhHHHhhcCChHHHHHhhCCCCcHhHHHHHHHHHHHhhcCCCCCCCHHHHHhHHHHH
Q psy10729         81 SPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLL  160 (363)
Q Consensus        81 ~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~ll~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~~~~~i~~l  160 (363)
                      +++..++++|+|+|+|++.+++.+|+.+...|++++|+.++...+...+.+++.|+|+|||++.+|.+.+.....++|.|
T Consensus       163 s~~~~v~eQavWALgNIagds~~~Rd~vl~~g~l~pLl~~l~~~~~~~~lRn~tW~LsNlcrgk~P~P~~~~v~~iLp~L  242 (514)
T KOG0166|consen  163 SPSADVREQAVWALGNIAGDSPDCRDYVLSCGALDPLLRLLNKSDKLSMLRNATWTLSNLCRGKNPSPPFDVVAPILPAL  242 (514)
T ss_pred             CCcHHHHHHHHHHHhccccCChHHHHHHHhhcchHHHHHHhccccchHHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999987767899999999999999999999999999999999


Q ss_pred             HHhhccCChhhHHHHHHHHHHhccCChhhHHHHHhcCChHHHHHhhcCCChhhHHHHHHHHHHhhcCChhHHHHHHHcCc
Q psy10729        161 NQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGG  240 (363)
Q Consensus       161 ~~ll~~~~~~v~~~al~~L~~l~~~~~~~~~~~~~~g~l~~l~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~l~~~~~  240 (363)
                      ..++++.|+++..+++|++++++.++++.++.+++.|++|.|+.+|.++++.++..|+++++|++.+++.+.+.+++.|+
T Consensus       243 ~~ll~~~D~~Vl~Da~WAlsyLsdg~ne~iq~vi~~gvv~~LV~lL~~~~~~v~~PaLRaiGNIvtG~d~QTq~vi~~~~  322 (514)
T KOG0166|consen  243 LRLLHSTDEEVLTDACWALSYLTDGSNEKIQMVIDAGVVPRLVDLLGHSSPKVVTPALRAIGNIVTGSDEQTQVVINSGA  322 (514)
T ss_pred             HHHHhcCCHHHHHHHHHHHHHHhcCChHHHHHHHHccchHHHHHHHcCCCcccccHHHhhccceeeccHHHHHHHHhcCh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHhhc-CChHhHHHHHHHHHHHHhcCCHHHHHHHHH----------------------------------------
Q psy10729        241 LQKMKKLLS-SSRVNIVKEAAWTISNITAGNSRQIDHVIQ----------------------------------------  279 (363)
Q Consensus       241 l~~L~~~l~-~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~----------------------------------------  279 (363)
                      ++.|..++. ++...++++|+|+++|++.++.++++.+++                                        
T Consensus       323 L~~l~~ll~~s~~~~ikkEAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~~~ef~~rKEAawaIsN~ts~g~~~qi~y  402 (514)
T KOG0166|consen  323 LPVLSNLLSSSPKESIKKEACWTISNITAGNQEQIQAVIDANLIPVLINLLQTAEFDIRKEAAWAISNLTSSGTPEQIKY  402 (514)
T ss_pred             HHHHHHHhccCcchhHHHHHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHhccchHHHHHHHHHHHhhcccCCHHHHHH
Confidence            999999998 566779999999999999999999998887                                        


Q ss_pred             --------------------------HHHHHHHHHHHhcccc--hHHHHHHHHcCcHHHHHHHhcCCcHHHHHHHHHHHH
Q psy10729        280 --------------------------EGLDNLLEIALQVGEL--NQMALLVEESGGLEKLEALQHHENETVYQKCYKIIS  331 (363)
Q Consensus       280 --------------------------~~l~~ll~~~~~~~~~--~~~~~~l~~~~~~~~L~~l~~~~~~~v~~~a~~~l~  331 (363)
                                                +++.+|++.++.....  +.+..+++++||+++++.|++|+|.+++++|..++.
T Consensus       403 Lv~~giI~plcdlL~~~D~~ii~v~Ld~l~nil~~~e~~~~~~~n~~~~~IEe~ggldkiE~LQ~hen~~Iy~~A~~II~  482 (514)
T KOG0166|consen  403 LVEQGIIKPLCDLLTCPDVKIILVALDGLENILKVGEAEKNRGTNPLAIMIEEAGGLDKIENLQSHENEEIYKKAYKIID  482 (514)
T ss_pred             HHHcCCchhhhhcccCCChHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHccChhHHHHhhccccHHHHHHHHHHHH
Confidence                                      6777888877776543  889999999999999999999999999999999999


Q ss_pred             hhcCCCccCcc--CCCCccccCCCCCCCCCCCCC
Q psy10729        332 MAFNDSAENSI--ENGDTIEFNPQPVNTVNGFNF  363 (363)
Q Consensus       332 ~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~  363 (363)
                      +||.++++++.  +.-++|.|+++  .|.|||||
T Consensus       483 ~yf~~e~~~~~~~~~~~~~~~~~~--~~~~~f~f  514 (514)
T KOG0166|consen  483 TYFSEEDDEDDQQPTTSQFTFQVQ--APDGGFNF  514 (514)
T ss_pred             HhcCCCcccccccccccccccCCC--CCCCCCCC
Confidence            99999855553  23338888888  59999999



>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF12463 DUF3689: Protein of unknown function (DUF3689) ; InterPro: IPR022162 This family of proteins is found in eukaryotes Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF04064 DUF384: Domain of unknown function (DUF384); InterPro: IPR007206 This is a protein of unknown function Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG1848|consensus Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1788|consensus Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>PF12726 SEN1_N: SEN1 N terminal; InterPro: IPR024481 The yeast helicase Sen1 is an RNA polymerase II termination factor for noncoding RNA genes [] Back     alignment and domain information
>PF11229 DUF3028: Protein of unknown function (DUF3028); InterPro: IPR021392 This eukaryotic family of proteins has no known function Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG2038|consensus Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF14726 RTTN_N: Rotatin, an armadillo repeat protein, centriole functioning Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>PF14726 RTTN_N: Rotatin, an armadillo repeat protein, centriole functioning Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 2e-78
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 4e-77
1wa5_B530 Crystal Structure Of The Exportin Cse1p Complexed W 1e-76
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 2e-76
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 5e-76
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 6e-76
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 7e-76
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 7e-76
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 7e-76
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 7e-76
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 8e-76
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 9e-76
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-75
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 1e-75
4b8j_A528 Rimp_alpha1a Length = 528 2e-75
2yns_A490 Rimp_alpha_b54nls Length = 490 2e-75
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 2e-75
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 3e-75
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 3e-75
1ial_A453 Importin Alpha, Mouse Length = 453 4e-75
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 4e-75
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 4e-75
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 4e-75
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 4e-75
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 5e-75
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 5e-70
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 6e-70
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 2e-31
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 4e-28
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 2e-25
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 4e-23
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 4e-23
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 1e-20
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 3e-15
1luj_A 514 Crystal Structure Of The Beta-CateninICAT COMPLEX L 8e-05
1i7x_A 538 Beta-CateninE-Cadherin Complex Length = 538 9e-05
2bct_A 516 The Armadillo Repeat Region From Murine Beta-Cateni 9e-05
1jpw_A 540 Crystal Structure Of A Human Tcf-4 BETA-Catenin Com 9e-05
2z6h_A 644 Crystal Structure Of Beta-Catenin Armadillo Repeat 9e-05
3tx7_A 527 Crystal Structure Of Lrh-1BETA-Catenin Complex Leng 9e-05
1t08_A 519 Crystal Structure Of Beta-CateninICAT HELICAL Domai 9e-05
2gl7_A 550 Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX 9e-05
4djs_A 518 Structure Of Beta-Catenin In Complex With A Stapled 9e-05
3ouw_A 540 Structure Of Beta-Catenin With Lef-1 Length = 540 9e-05
1jdh_A 529 Crystal Structure Of Beta-Catenin And Htcf-4 Length 9e-05
1qz7_A 533 Beta-Catenin Binding Domain Of Axin In Complex With 9e-05
1g3j_A 532 Crystal Structure Of The Xtcf3-CbdBETA-Catenin Arma 9e-05
3sla_A168 X-Ray Structure Of First Four Repeats Of Human Beta 1e-04
3sl9_A167 X-Ray Structure Of Beta Catenin In Complex With Bcl 1e-04
2z6g_A 780 Crystal Structure Of A Full-Length Zebrafish Beta-C 2e-04
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure

Iteration: 1

Score = 289 bits (740), Expect = 2e-78, Method: Compositional matrix adjust. Identities = 168/434 (38%), Positives = 237/434 (54%), Gaps = 81/434 (18%) Query: 2 RMIATRSARKMLSKERHPPIDELIEAGVVPICVELLD--DENPNTQFEATWALTNIASGT 59 ++ AT++ARK+LS+E+ PPID +I AG++P V L D +P QFE+ WALTNIASGT Sbjct: 93 QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSP-IQFESAWALTNIASGT 151 Query: 60 SEQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIXXXXXXXXXXXXXXXTMPQILA 119 SEQT V++ AIP F+ LL+SPH +++EQA WALGNI + +LA Sbjct: 152 SEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGAGSAFRDLVIKHGAIDPLLA 211 Query: 120 LVQ-PNTPT---TFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDI 175 L+ P+ T +LRN+ W +SNLCRNKNPAP + ++ LP L +L+H D E L+D Sbjct: 212 LLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS 271 Query: 176 CWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCV 235 CWA+SY++DG N++I+ VV GVVP+LV+LL + E I+T ALR +GNI TG D QT V Sbjct: 272 CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKV 331 Query: 236 IQAGGLQKMKKLLSSSRVNIVKEA------------------------------------ 259 I AG L LL++ + NI KEA Sbjct: 332 IDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADF 391 Query: 260 ------AWTISNITAGNS------------------------RQIDHVIQEGLDNLLEIA 289 AW I+N T+G + +I VI + + N+ + A Sbjct: 392 KTQKAAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAA 451 Query: 290 LQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIENGDTIE 349 ++GE ++++++EE GGL+K+EALQ HENE+VY+ +I F+ E + Sbjct: 452 EKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEE--------D 503 Query: 350 FNPQPVNTVNGFNF 363 N P T GF F Sbjct: 504 QNVVPETTSEGFAF 517
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|1LUJ|A Chain A, Crystal Structure Of The Beta-CateninICAT COMPLEX Length = 514 Back     alignment and structure
>pdb|1I7X|A Chain A, Beta-CateninE-Cadherin Complex Length = 538 Back     alignment and structure
>pdb|2BCT|A Chain A, The Armadillo Repeat Region From Murine Beta-Catenin Length = 516 Back     alignment and structure
>pdb|1JPW|A Chain A, Crystal Structure Of A Human Tcf-4 BETA-Catenin Complex Length = 540 Back     alignment and structure
>pdb|2Z6H|A Chain A, Crystal Structure Of Beta-Catenin Armadillo Repeat Region And Its C-Terminal Domain Length = 644 Back     alignment and structure
>pdb|3TX7|A Chain A, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 527 Back     alignment and structure
>pdb|1T08|A Chain A, Crystal Structure Of Beta-CateninICAT HELICAL DomainUNPHOSPHORYLATED APC R3 Length = 519 Back     alignment and structure
>pdb|2GL7|A Chain A, Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX Length = 550 Back     alignment and structure
>pdb|4DJS|A Chain A, Structure Of Beta-Catenin In Complex With A Stapled Peptide Inhibitor Length = 518 Back     alignment and structure
>pdb|3OUW|A Chain A, Structure Of Beta-Catenin With Lef-1 Length = 540 Back     alignment and structure
>pdb|1JDH|A Chain A, Crystal Structure Of Beta-Catenin And Htcf-4 Length = 529 Back     alignment and structure
>pdb|1QZ7|A Chain A, Beta-Catenin Binding Domain Of Axin In Complex With Beta- Catenin Length = 533 Back     alignment and structure
>pdb|1G3J|A Chain A, Crystal Structure Of The Xtcf3-CbdBETA-Catenin Armadillo Repeat Complex Length = 532 Back     alignment and structure
>pdb|3SLA|A Chain A, X-Ray Structure Of First Four Repeats Of Human Beta-Catenin Length = 168 Back     alignment and structure
>pdb|3SL9|A Chain A, X-Ray Structure Of Beta Catenin In Complex With Bcl9 Length = 167 Back     alignment and structure
>pdb|2Z6G|A Chain A, Crystal Structure Of A Full-Length Zebrafish Beta-Catenin Length = 780 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-107
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-53
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-39
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-28
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-101
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-55
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 2e-30
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-19
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-101
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 4e-24
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 7e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-69
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 8e-51
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-66
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 5e-48
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-43
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-39
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-38
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-35
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-33
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-63
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-48
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-43
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-39
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-36
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-34
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-19
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-56
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-43
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-38
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-35
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-55
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-47
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 9e-40
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-49
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-46
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-27
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 1e-09
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-45
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-37
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-26
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-13
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-35
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-13
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-34
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 5e-14
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 7e-14
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-10
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-07
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-32
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-23
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-13
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-12
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-31
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-29
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-22
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 4e-26
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-12
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-11
2db0_A253 253AA long hypothetical protein; heat repeats, hel 4e-12
2db0_A253 253AA long hypothetical protein; heat repeats, hel 4e-10
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-11
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 8e-07
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 4e-08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 4e-08
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-05
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 4e-07
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 6e-06
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 7e-04
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 7e-07
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 4e-04
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 1e-06
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 4e-05
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 2e-04
1qgr_A 876 Protein (importin beta subunit); transport recepto 3e-04
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 6e-04
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
 Score =  321 bits (823), Expect = e-107
 Identities = 161/376 (42%), Positives = 207/376 (55%), Gaps = 20/376 (5%)

Query: 5   ATRSARKMLSKERHPPIDELI-EAGVVPICVELLD-DENPNTQFEATWALTNIASGTSEQ 62
           AT+  RK+LSKE +PPIDE+I   GVV   VE L   EN   QFE+ W LTNIASG S Q
Sbjct: 40  ATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQ 99

Query: 63  TMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQ 122
           T  VI A A+P F++LLSS   ++ EQA WALGNIAGD    RD +L    +P +L L  
Sbjct: 100 TRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFS 159

Query: 123 PNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALSYI 182
                T  RN VWA+SNLCR K+P P+F K+  CL +L+ L+  +D + L+D CWALSY+
Sbjct: 160 KQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL 219

Query: 183 SDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGGLQ 242
           SDG NDKIQAV+D GV  RLVELL   +  +++ ALR VGNI TG+D QT  ++    LQ
Sbjct: 220 SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQ 279

Query: 243 KMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDNLLEIALQVGEL------- 295
            +  LLSS + +I KEA WTISNITAGN  QI  VI   +   L   LQ  E        
Sbjct: 280 SLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAA 339

Query: 296 -----------NQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAENSIEN 344
                       +    + E G ++ L  L    +  + Q     +        + +  N
Sbjct: 340 WAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRN 399

Query: 345 GDTIEFNPQPVNTVNG 360
           G  I      +    G
Sbjct: 400 GTGINPYCALIEEAYG 415


>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Length = 265 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Length = 462 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.97
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.97
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.97
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.97
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.97
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.97
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.97
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.97
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.96
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.96
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.96
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.96
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.95
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.95
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.94
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.94
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.91
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.9
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.85
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.85
3grl_A 651 General vesicular transport factor P115; vesicle t 99.72
3grl_A 651 General vesicular transport factor P115; vesicle t 99.66
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.64
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.57
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.54
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.52
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.51
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.49
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.49
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.48
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.47
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.46
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.46
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.43
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.36
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.3
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.27
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.26
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.24
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.23
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.21
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.2
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.2
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.19
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.06
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.0
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.92
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.91
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.89
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.88
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.81
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.81
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.8
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.8
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.75
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.74
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.74
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.72
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.72
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.58
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.55
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.54
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.49
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.38
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.02
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.02
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.98
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.96
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 97.7
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.65
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.63
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.62
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.57
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.37
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.36
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.34
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.3
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.27
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 97.24
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.11
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.09
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 96.86
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 96.76
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.63
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.61
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 96.54
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.52
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.51
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 96.48
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 96.45
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 96.41
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.35
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.26
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 96.25
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.22
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 96.09
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.09
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 95.96
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 95.72
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 95.64
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 95.6
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 95.39
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 95.31
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 94.24
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.15
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 94.09
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 93.97
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 93.34
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 93.15
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 91.52
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 90.43
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 90.33
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 90.31
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 89.73
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 87.46
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 86.03
3fga_B403 Serine/threonine-protein phosphatase 2A 56 kDa RE 84.05
1vdy_A140 Hypothetical protein (RAFL09-17-B18); structural g 82.53
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 80.6
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 80.25
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
Probab=100.00  E-value=1.9e-51  Score=387.22  Aligned_cols=361  Identities=48%  Similarity=0.834  Sum_probs=308.0

Q ss_pred             hhHHHHHHHHhhcCCCCCcHHHHHHcCCHHHHHHhcC-CCChhHHHHHHHHHHHhcCCChHhHHHHHhCCChHHHHHhcC
Q psy10729          2 RMIATRSARKMLSKERHPPIDELIEAGVVPICVELLD-DENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLS   80 (363)
Q Consensus         2 q~~a~~~l~~~l~~~~~~~~~~~~~~g~l~~L~~lL~-~~~~~i~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~l~~ll~   80 (363)
                      |++|+..+|++++.+.+++++.+++.|++|.|+++|+ ++++++|..|+|+|+|++.++++.+..+++.|++|.|+.+|+
T Consensus        74 q~~a~~~~rklls~e~~ppi~~ii~~G~ip~LV~lL~~~~~~~lq~~Aa~aL~nias~~~e~~~~vv~~GaIp~Lv~lL~  153 (510)
T 3ul1_B           74 QLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA  153 (510)
T ss_dssp             HHHHHHHHHHHHTCSSCCCHHHHHHTTHHHHHHHHTTCTTCHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHTT
T ss_pred             HHHHHHHHHHHhcCCCCchHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCHHHHHHHHHCCCHHHHHHHHc
Confidence            8899999999999999999999999999999999995 567899999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHhhCCCCchhHHHhhcCChHHHHHhhCCCCc----HhHHHHHHHHHHHhhcCCCCCCCHHHHHhH
Q psy10729         81 SPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTP----TTFLRNIVWAISNLCRNKNPAPDFEKIKIC  156 (363)
Q Consensus        81 ~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~ll~~~~~----~~~~~~~~~~L~~l~~~~~~~~~~~~~~~~  156 (363)
                      ++++++++.|+|+|+||+.+++..|..+...|++++|+.++...+.    ..+.+.++|++++++.+..+........++
T Consensus       154 s~~~~v~e~A~~aL~nLa~d~~~~r~~v~~~G~i~~Ll~lL~~~~~~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~  233 (510)
T 3ul1_B          154 SPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQI  233 (510)
T ss_dssp             CSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTCSSCGGGSCHHHHHHHHHHHHHHHCCCSSCCCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHhCCHHHHHHHHHcCChHHHHHHHHhccchhhhHHHHHHHHHHHHHHhhcccchhHHHHHHhH
Confidence            9999999999999999999999999999999999999999985542    357889999999999998788888888999


Q ss_pred             HHHHHHhhccCChhhHHHHHHHHHHhccCChhhHHHHHhcCChHHHHHhhcCCChhhHHHHHHHHHHhhcCChhHHHHHH
Q psy10729        157 LPLLNQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVI  236 (363)
Q Consensus       157 i~~l~~ll~~~~~~v~~~al~~L~~l~~~~~~~~~~~~~~g~l~~l~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~l~  236 (363)
                      +|.|+.++++++++++..++++|++++..+++....+.+.|+++.|++++.++++.++..++++|+|++.+++.....++
T Consensus       234 lp~L~~LL~~~~~~v~~~A~~aL~~L~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~al~aL~nl~~~~~~~~~~i~  313 (510)
T 3ul1_B          234 LPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVI  313 (510)
T ss_dssp             HHHHHHHTTCSCHHHHHHHHHHHHHHTSSCHHHHHHHHTTTCHHHHHHHHTCSCHHHHHHHHHHHHHHTTSCHHHHHHHH
T ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHHHhhchhhhHHHHHhcccchhhhhhhcCCChhhhhHHHHHHHHhhcCCHHHHHHHh
Confidence            99999999999999999999999999999988888889999999999999999999999999999999999999999999


Q ss_pred             HcCchHHHHHhhcCChHhHHHHHHHHHHHHhcCCHHHHHHHHH-------------------------------------
Q psy10729        237 QAGGLQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQ-------------------------------------  279 (363)
Q Consensus       237 ~~~~l~~L~~~l~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~-------------------------------------  279 (363)
                      +.|+++.|+.++.++++.+++.|+|+|+|++.+++.+...+++                                     
T Consensus       314 ~~g~l~~L~~LL~~~~~~v~~~A~~aL~nl~a~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~Aa~aL~Nl~~~~~~~~  393 (510)
T 3ul1_B          314 DAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQ  393 (510)
T ss_dssp             HTTGGGGCC-CTTCSSHHHHHHHHHHHHHHTTSCHHHHHHHHHTTHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHCCHHH
T ss_pred             hccchHHHHHHhcCCCHHHHHHHHHHHHHHHcCcHHHHHHHHhcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHccCCHHH
Confidence            9999999999999999999999999999999988777666554                                     


Q ss_pred             -----------------------------HHHHHHHHHHHhcccchHHHHHHHHcCcHHHHHHHhcCCcHHHHHHHHHHH
Q psy10729        280 -----------------------------EGLDNLLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKII  330 (363)
Q Consensus       280 -----------------------------~~l~~ll~~~~~~~~~~~~~~~l~~~~~~~~L~~l~~~~~~~v~~~a~~~l  330 (363)
                                                   +++.+|++.+++....+.++..++++||+++|+.|++|+|.+|+++|..+|
T Consensus       394 ~~~L~~~g~i~~L~~LL~~~d~~i~~~~L~aL~nil~~~~~~~~~~~~~~~iee~ggl~~ie~Lq~~~n~~i~~~A~~ii  473 (510)
T 3ul1_B          394 IVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLI  473 (510)
T ss_dssp             HHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHH
T ss_pred             HHHHHHCCCHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhHhccchHHHHHHHHHcCcHHHHHHHHcCCCHHHHHHHHHHH
Confidence                                         455566666666666778889999999999999999999999999999999


Q ss_pred             HhhcCCCccCcc-----CCCCccccCCCCCCCCCCCCC
Q psy10729        331 SMAFNDSAENSI-----ENGDTIEFNPQPVNTVNGFNF  363 (363)
Q Consensus       331 ~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~  363 (363)
                      ++||.++++++.     ...+.|+|+++.. ++|||||
T Consensus       474 e~yf~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~  510 (510)
T 3ul1_B          474 EKYFSVEEEEDQNVVPETTSEGFAFQVQDG-APGTFNF  510 (510)
T ss_dssp             HHHCC---------------------------------
T ss_pred             HHHCCCccccccccCCCCCccccccCCCCC-CCCCCCC
Confidence            999998766555     3345799987766 6799999



>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3fga_B Serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; PP2A, shugoshin, nucleus, phosphoprotein, hydrolase, iron, M metal-binding, methylation, protein phosphatase, cell cycle division; HET: 1ZN; 2.70A {Homo sapiens} PDB: 2iae_B* 2nym_B* 2nyl_B* Back     alignment and structure
>1vdy_A Hypothetical protein (RAFL09-17-B18); structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Arabidopsis thaliana} PDB: 2dcp_A Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 363
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-47
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 1e-12
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 4e-08
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 4e-39
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 3e-12
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-09
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-04
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-28
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-15
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-10
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-08
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-07
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 7e-18
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 2e-04
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-13
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-11
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-08
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-07
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 0.001
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 1e-07
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 5e-07
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 2e-06
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.003
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 0.004
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  166 bits (419), Expect = 2e-47
 Identities = 154/382 (40%), Positives = 205/382 (53%), Gaps = 22/382 (5%)

Query: 2   RMIATRSARKMLSKERHPPIDELIEAGVVPICVEL-LDDENPNTQFEATWALTNIASGTS 60
           ++ AT   R++LS+E  PPID +I+AGVVP  VE   +++    Q EA WALTNIASGTS
Sbjct: 93  QLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTS 152

Query: 61  EQTMTVINANAIPKFLQLLSSPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILAL 120
            QT  V++A+A+P F+QLL +  + + EQA WALGN+AGD    RD +L    M  IL L
Sbjct: 153 AQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGL 212

Query: 121 VQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLLNQLIHTTDVETLSDICWALS 180
              N P+  +R   W +SNLCR K P PD+  +   LP L +LI++ D ETL D CWA+S
Sbjct: 213 FNSNKPS-LIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAIS 271

Query: 181 YISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGG 240
           Y+SDG  + IQAV+D  +  RLVELL  E T + T ALR VGNI TGND QT  VI AG 
Sbjct: 272 YLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGV 331

Query: 241 LQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQEGLDN---------------- 284
           L  ++ LLSS + NI KEA WTISNITAGN+ QI  VI   L                  
Sbjct: 332 LPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKE 391

Query: 285 ----LLEIALQVGELNQMALLVEESGGLEKLEALQHHENETVYQKCYKIISMAFNDSAEN 340
               +   +    +   +   +   G ++ L  L    +  + +     +         +
Sbjct: 392 ACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEAD 451

Query: 341 SIENGDTIEFNPQPVNTVNGFN 362
               G  I  N   +    G  
Sbjct: 452 KEARGLNINENADFIEKAGGME 473


>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.96
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.95
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.88
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.85
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.38
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.34
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.33
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.24
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.12
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.03
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.02
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.91
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.9
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.86
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.79
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.69
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.63
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.57
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.53
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.52
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.38
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.35
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.98
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.91
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.37
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 95.84
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.76
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 95.69
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 94.92
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 93.79
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 92.23
d2jaka1343 Serine/threonine-protein phosphatase 2A regulatory 84.69
d2jaka1343 Serine/threonine-protein phosphatase 2A regulatory 84.23
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 80.39
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=3.4e-39  Score=302.01  Aligned_cols=337  Identities=49%  Similarity=0.789  Sum_probs=303.3

Q ss_pred             hhHHHHHHHHhhcCCCCCcHHHHHHcCCHHHHHHhcC-CCChhHHHHHHHHHHHhcCCChHhHHHHHhCCChHHHHHhcC
Q psy10729          2 RMIATRSARKMLSKERHPPIDELIEAGVVPICVELLD-DENPNTQFEATWALTNIASGTSEQTMTVINANAIPKFLQLLS   80 (363)
Q Consensus         2 q~~a~~~l~~~l~~~~~~~~~~~~~~g~l~~L~~lL~-~~~~~i~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~l~~ll~   80 (363)
                      |+.|+..++++++...+++++.+++.|++|.|++++. +.++.++..|+++|++++.+++.....+.+.|+++.++.++.
T Consensus        93 ~~~a~~~~r~~ls~~~~~~i~~ii~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~g~i~~l~~lL~  172 (503)
T d1wa5b_          93 QLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLY  172 (503)
T ss_dssp             HHHHHHHHHHHTCCSSSCSHHHHHHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcCCCchHHHHHHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHHHhc
Confidence            6789999999999888899999999999999999995 567889999999999999888888999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHhhCCCCchhHHHhhcCChHHHHHhhCCCCcHhHHHHHHHHHHHhhcCCCCCCCHHHHHhHHHHH
Q psy10729         81 SPHLNLAEQATWALGNIAGDGARARDLLLGLGTMPQILALVQPNTPTTFLRNIVWAISNLCRNKNPAPDFEKIKICLPLL  160 (363)
Q Consensus        81 ~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~ll~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~~~~~i~~l  160 (363)
                      +++.+++..++|+|+|++.+++..+..+...|++++++.++.+.+ ..++..++|++.+++.+..+........+++|.+
T Consensus       173 s~~~~i~~~a~~~L~nia~~~~~~r~~l~~~~~~~~L~~ll~~~~-~~~~~~~~~~l~nl~~~~~~~~~~~~~~~~l~~l  251 (503)
T d1wa5b_         173 TGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNK-PSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTL  251 (503)
T ss_dssp             HCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHGGGSCC-HHHHHHHHHHHHHHHCCSSSCCCHHHHGGGHHHH
T ss_pred             CCChhHHHHHHHHHHHHhhhhHHHHHHHHhhcccccchhhcccCC-HHHHHHHHHHHHHHhcCCccchHHHHHHHHHHHH
Confidence            999999999999999999998899999999999999999998777 4899999999999999877777888889999999


Q ss_pred             HHhhccCChhhHHHHHHHHHHhccCChhhHHHHHhcCChHHHHHhhcCCChhhHHHHHHHHHHhhcCChhHHHHHHHcCc
Q psy10729        161 NQLIHTTDVETLSDICWALSYISDGHNDKIQAVVDTGVVPRLVELLDSEETTILTAALRTVGNIATGNDHQTDCVIQAGG  240 (363)
Q Consensus       161 ~~ll~~~~~~v~~~al~~L~~l~~~~~~~~~~~~~~g~l~~l~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~l~~~~~  240 (363)
                      ..++.+.|++++..+++++.+++...++....+++.|+++.++.++.++++.++..|+.++++++.+++.....+++.|+
T Consensus       252 ~~~l~~~d~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~nl~~~~~~~~~~~~~~~~  331 (503)
T d1wa5b_         252 AKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGV  331 (503)
T ss_dssp             HHHTTCCCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTH
T ss_pred             HHHhccccHHHHHHHHHHHHhhccCCchhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHHHHHHHHHHHHHhhhccch
Confidence            99999999999999999999999988888888999999999999999999999999999999999988888889999999


Q ss_pred             hHHHHHhhcCChHhHHHHHHHHHHHHhcCCHHHHHHHHH-----------------------------------------
Q psy10729        241 LQKMKKLLSSSRVNIVKEAAWTISNITAGNSRQIDHVIQ-----------------------------------------  279 (363)
Q Consensus       241 l~~L~~~l~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~-----------------------------------------  279 (363)
                      ++.+..+++++++.+++.++|+|+|++.+++.++..+++                                         
T Consensus       332 l~~l~~ll~~~~~~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~~~l~nl~~~~~~~~~~~~  411 (503)
T d1wa5b_         332 LPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIR  411 (503)
T ss_dssp             HHHHHHHTTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHHHHHHHHHHHTTTCTHHHH
T ss_pred             HHHHHHHhcCCCHHHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccCChhHHHHHHHHHHHHHhcccccHHHHH
Confidence            999999999999999999999999999988877766665                                         


Q ss_pred             ---------------------------HHHHHHHHHHHhcc-----cchHHHHHHHHcCcHHHHHHHhcCCcHHHHHHHH
Q psy10729        280 ---------------------------EGLDNLLEIALQVG-----ELNQMALLVEESGGLEKLEALQHHENETVYQKCY  327 (363)
Q Consensus       280 ---------------------------~~l~~ll~~~~~~~-----~~~~~~~~l~~~~~~~~L~~l~~~~~~~v~~~a~  327 (363)
                                                 +++..+++.+....     ..+.+...+.++||++.|+.|+++++++|++.|.
T Consensus       412 ~l~~~~~l~~l~~~L~~~d~~~~~~~L~~l~~ll~~~~~~~~~~~~~~~~~~~~iee~g~~~~i~~Lq~~~~~~i~~~A~  491 (503)
T d1wa5b_         412 YLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAY  491 (503)
T ss_dssp             HHHHTTCHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCHHHHHHHHTTHHHHHHGGGGCSCHHHHHHHH
T ss_pred             HHHHCCcHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHhhhhcccchHHHHHHHHCCCHHHHHHHHcCCCHHHHHHHH
Confidence                                       22333333332211     2356777899999999999999999999999999


Q ss_pred             HHHHhhcCCCcc
Q psy10729        328 KIISMAFNDSAE  339 (363)
Q Consensus       328 ~~l~~~~~~~~~  339 (363)
                      ++|++||++++|
T Consensus       492 ~il~~~f~~~~~  503 (503)
T d1wa5b_         492 KIIETYFGEEED  503 (503)
T ss_dssp             HHHHHHSSSCC-
T ss_pred             HHHHHHcCCcCC
Confidence            999999988875



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure