Diaphorina citri psyllid: psy1072

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----

MSSSISRYANIIFVVALYWCVSITTIFLNKTLLSELQLDAPIFVTWYQCLVSAIICFVLCQLSQQYPKNFSFPYGNPFDTNNMRNLVPLTSCFILMLSFNNLCLKNVGVAFYYVSRSLTTVFNVILTYILLQEKTSHLAILSCFIIFSGFALGVNQEGVAGSFSTLGTIYGVISSFAQALFSIHTKEVLPYVNDKIWLVSYYNNVYAVALFIPIIFICGEVSELANYPHLFSFYFWILLTIGGVFGLTIGYVTSLQIQVTSPLTHNISGTAKASFHTVLATYWYSEFKPLLWWISNGIILSGSATYALVKKKELDRRKDMEELL

cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccEEECcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccc

******RYANIIFVVALYWCVSITTIFLNKTLLSELQLDAPIFVTWYQCLVSAIICFVLCQLSQQYPKNFSFPYGNPFDTNNMRNLVPLTSCFILMLSFNNLCLKNVGVAFYYVSRSLTTVFNVILTYILLQEKTSHLAILSCFIIFSGFALGVNQEGVAGSFSTLGTIYGVISSFAQALFSIHTKEVLPYVNDKIWLVSYYNNVYAVALFIPIIFICGEVSELANYPHLFSFYFWILLTIGGVFGLTIGYVTSLQIQVTSPLTHNISGTAKASFHTVLATYWYSEFKPLLWWISNGIILSGSATYALVK**************

xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GDP-fucose transporter	Involved in GDP-fucose import from the cytoplasm into the Golgi lumen.	very confident	Q968A5
GDP-fucose transporter 1	Involved in GDP-fucose import from the cytoplasm into the Golgi lumen.	very confident	Q96A29
GDP-fucose transporter 1	Involved in GDP-fucose import from the cytoplasm into the Golgi lumen.	very confident	Q8BLX4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030259 [BP]	lipid glycosylation	probable	GO:0044238, GO:0044710, GO:0005975, GO:0006629, GO:0009987, GO:0070085, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044723, GO:0044255, GO:0030258
GO:2000460 [BP]	regulation of eukaryotic cell surface binding	probable
GO:0045746 [BP]	negative regulation of Notch signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0000139 [CC]	Golgi membrane	probable	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0072334 [BP]	UDP-galactose transmembrane transport	probable	GO:0015931, GO:0006862, GO:0006820, GO:0051179, GO:0034219, GO:0044699, GO:1901264, GO:0008643, GO:0071705, GO:0071702, GO:0009987, GO:0006811, GO:0006810, GO:0015711, GO:0034220, GO:0044765, GO:0044763, GO:0051234, GO:0055085, GO:0072531, GO:1901679, GO:0015781, GO:0015780, GO:0015785, GO:0090481, GO:0015748, GO:0008150
GO:0015783 [BP]	GDP-fucose transport	probable	GO:0015931, GO:0006810, GO:0071702, GO:0015780, GO:0006862, GO:0036079, GO:0071705, GO:0044765, GO:0008150, GO:0015748, GO:0051234, GO:0051179, GO:0044699, GO:1901264
GO:0015786 [BP]	UDP-glucose transport	probable	GO:0015931, GO:0006810, GO:0015748, GO:0015781, GO:0015780, GO:0006862, GO:0015711, GO:0051179, GO:0044765, GO:0006820, GO:0071705, GO:0008150, GO:0071702, GO:0051234, GO:0006811, GO:0044699, GO:1901264
GO:0005342 [MF]	organic acid transmembrane transporter activity	probable	GO:0022891, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005460 [MF]	UDP-glucose transmembrane transporter activity	probable	GO:0022891, GO:0015932, GO:0022892, GO:0008514, GO:0005215, GO:0008509, GO:0005338, GO:1901677, GO:0015075, GO:0015215, GO:0022857, GO:0003674, GO:0015165, GO:1901505
GO:0005459 [MF]	UDP-galactose transmembrane transporter activity	probable	GO:0022891, GO:0015932, GO:0022892, GO:0015215, GO:0005215, GO:0005338, GO:1901677, GO:0022857, GO:0003674, GO:0015165, GO:1901505
GO:0005457 [MF]	GDP-fucose transmembrane transporter activity	probable	GO:0022891, GO:0015932, GO:0005338, GO:0015215, GO:0005215, GO:0036080, GO:1901677, GO:0022857, GO:0022892, GO:0003674, GO:1901505
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015718 [BP]	monocarboxylic acid transport	probable	GO:0015849, GO:0006811, GO:0006810, GO:0006820, GO:0015711, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015297 [MF]	antiporter activity	probable	GO:0005215, GO:0022857, GO:0015291, GO:0003674, GO:0022804

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 87-156
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 242-309
View the alignment between query and template
View the model in PyMOL