Diaphorina citri psyllid: psy10736


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MGVQPNDRLKIAREFGDKAAERRANSNLGNSHIFLGEYQAASEHYKRTLVLAQDLGDRAVEAQACYSLGNTYTLLRDYPTAIDYHLRHLIIAQQLMDRVGEGMI
ccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHcccc
MGVQPNDRLKIAREFGDKAAERRANSNLGNSHIFLGEYQAASEHYKRTLVLAQDLGDRAVEAQACYSLGNTYTLLRDYPTAIDYHLRHLIIAQQLMDRVGEGMI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVQPNDRLKIAREFGDKAAERRANSNLGNSHIFLGEYQAASEHYKRTLVLAQDLGDRAVEAQACYSLGNTYTLLRDYPTAIDYHLRHLIIAQQLMDRVGEGMI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G-protein-signaling modulator 2 Plays an important role in spindle pole orientation (By similarity). Interacts and contributes to the functional activity of G(i) alpha proteins. Acts to stabilize the apical complex during neuroblast divisions.confidentQ8VDU0
G-protein-signaling modulator 2 Plays an important role in spindle pole orientation. Interacts and contributes to the functional activity of G(i) alpha proteins. Acts to stabilize the apical complex during neuroblast divisions.confidentP81274

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partconfidentGO:0005575, GO:0005623
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0001965 [MF]G-protein alpha-subunit bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008277 [BP]regulation of G-protein coupled receptor protein signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005092 [MF]GDP-dissociation inhibitor activityprobableGO:0030695, GO:0005083, GO:0060589, GO:0030234, GO:0003674
GO:0055059 [BP]asymmetric neuroblast divisionprobableGO:0030154, GO:0055057, GO:0048103, GO:0007405, GO:0007275, GO:0051301, GO:0048869, GO:0008150, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731, GO:0072089
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0045167 [BP]asymmetric protein localization involved in cell fate determinationprobableGO:0032502, GO:0008105, GO:0008104, GO:0048869, GO:0001709, GO:0045165, GO:0044763, GO:0030154, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699
GO:0000132 [BP]establishment of mitotic spindle orientationprobableGO:0008104, GO:0051653, GO:0007163, GO:0000226, GO:0030010, GO:0051656, GO:0044699, GO:0040001, GO:0071840, GO:0016043, GO:0008150, GO:0007049, GO:0033036, GO:0006996, GO:0000278, GO:0051294, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0045175 [BP]basal protein localizationprobableGO:0033036, GO:0008105, GO:0008104, GO:0008150, GO:0051179
GO:0060487 [BP]lung epithelial cell differentiationprobableGO:0032502, GO:0030323, GO:0030324, GO:0030154, GO:0032501, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0030855, GO:0060541, GO:0009987, GO:0060428, GO:0060429, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0035295, GO:0044707, GO:0048856, GO:0060479, GO:0008150
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007400 [BP]neuroblast fate determinationprobableGO:0030154, GO:0007275, GO:0044699, GO:0014016, GO:0048863, GO:0048865, GO:0048867, GO:0048869, GO:0001709, GO:0008150, GO:0032502, GO:0032501, GO:0009987, GO:0014017, GO:0044763, GO:0022008, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SF4, chain A
Confidence level:very confident
Coverage over the Query: 4-99
View the alignment between query and template
View the model in PyMOL