Diaphorina citri psyllid: psy1073


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MPQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEccc
**QLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0016616 [MF]oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0003674, GO:0016614, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YB1, chain A
Confidence level:very confident
Coverage over the Query: 8-107
View the alignment between query and template
View the model in PyMOL