Psyllid ID: psy1073


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MPQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccEEEEccc
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccc
mpqlpyvndkIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSmcgvlglpnvvpycsskfavreghniylgswerTEMNYLFLAHCITTCNW
mpqlpyvnDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
MPQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
****PYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCN*
**QLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
MPQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
*PQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQLPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNYLFLAHCITTCNW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q7Z5P4300 17-beta-hydroxysteroid de yes N/A 0.364 0.13 0.641 7e-10
Q5M875300 17-beta-hydroxysteroid de yes N/A 0.373 0.133 0.55 2e-07
A5PJJ7316 Short-chain dehydrogenase no N/A 0.383 0.129 0.536 2e-07
Q8VCR2304 17-beta-hydroxysteroid de no N/A 0.373 0.131 0.55 4e-07
Q5NVG2300 Estradiol 17-beta-dehydro no N/A 0.607 0.216 0.385 9e-07
Q8NBQ5300 Estradiol 17-beta-dehydro no N/A 0.607 0.216 0.385 1e-06
Q4JK73300 Estradiol 17-beta-dehydro N/A N/A 0.607 0.216 0.385 1e-06
Q05A13316 Short-chain dehydrogenase no N/A 0.383 0.129 0.512 3e-06
Q7TQA3309 Epidermal retinol dehydro no N/A 0.364 0.126 0.538 3e-06
Q5XGF7341 Retinol dehydrogenase 10 no N/A 0.392 0.123 0.5 4e-06
>sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=2 SV=1 Back     alignment and function desciption
 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 38  EAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFA 76
           +A LPSM+ERNHGH+V ++S+CG  G+P ++PYCSSKFA
Sbjct: 153 KALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFA 191





Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=2 SV=1 Back     alignment and function description
>sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 Back     alignment and function description
>sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 Back     alignment and function description
>sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 Back     alignment and function description
>sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 Back     alignment and function description
>sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 Back     alignment and function description
>sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 Back     alignment and function description
>sp|Q5XGF7|RDH10_XENTR Retinol dehydrogenase 10 OS=Xenopus tropicalis GN=rdh10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
193591893 331 PREDICTED: estradiol 17-beta-dehydrogena 0.392 0.126 0.904 4e-16
383864620 316 PREDICTED: short-chain dehydrogenase/red 0.401 0.136 0.790 7e-13
307180161 312 Epidermal retinal dehydrogenase 2 [Campo 0.392 0.134 0.809 7e-13
332030877 306 Short chain dehydrogenase/reductase fami 0.392 0.137 0.785 2e-12
357602501 327 short-chain dehydrogenase [Danaus plexip 0.392 0.128 0.714 4e-12
307195057 307 Epidermal retinal dehydrogenase 2 [Harpe 0.392 0.136 0.785 4e-12
340721996 307 PREDICTED: short-chain dehydrogenase/red 0.392 0.136 0.690 6e-11
345497837 316 PREDICTED: epidermal retinol dehydrogena 0.392 0.132 0.714 8e-11
195046585 325 GH24349 [Drosophila grimshawi] gi|193893 0.392 0.129 0.714 9e-11
389609953 221 short-chain dehydrogenase [Papilio xuthu 0.392 0.190 0.690 1e-10
>gi|193591893|ref|XP_001951338.1| PREDICTED: estradiol 17-beta-dehydrogenase 11-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 41/42 (97%)

Query: 37  LEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVR 78
           LEAFLPSMIE NHGHV+ALSSMCGV+GLPNVVPYC+SKFAVR
Sbjct: 181 LEAFLPSMIENNHGHVIALSSMCGVIGLPNVVPYCASKFAVR 222




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383864620|ref|XP_003707776.1| PREDICTED: short-chain dehydrogenase/reductase family 16C member 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307180161|gb|EFN68195.1| Epidermal retinal dehydrogenase 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332030877|gb|EGI70513.1| Short chain dehydrogenase/reductase family 16C member 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357602501|gb|EHJ63420.1| short-chain dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
>gi|307195057|gb|EFN77115.1| Epidermal retinal dehydrogenase 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340721996|ref|XP_003399398.1| PREDICTED: short-chain dehydrogenase/reductase family 16C member 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345497837|ref|XP_001600199.2| PREDICTED: epidermal retinol dehydrogenase 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195046585|ref|XP_001992185.1| GH24349 [Drosophila grimshawi] gi|193893026|gb|EDV91892.1| GH24349 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|389609953|dbj|BAM18588.1| short-chain dehydrogenase [Papilio xuthus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
UNIPROTKB|Q7Z5P4300 HSD17B13 "17-beta-hydroxystero 0.364 0.13 0.641 2.7e-10
FB|FBgn0029994320 CG2254 [Drosophila melanogaste 0.392 0.131 0.666 3.3e-10
ZFIN|ZDB-GENE-040426-2049306 sdr16c5a "short chain dehydrog 0.383 0.133 0.487 1.2e-09
FB|FBgn0032405318 CG14946 [Drosophila melanogast 0.401 0.135 0.534 3.2e-09
UNIPROTKB|F1NUP9305 SDR16C5 "Uncharacterized prote 0.383 0.134 0.512 4e-09
UNIPROTKB|E2RJ96300 HSD17B13 "Uncharacterized prot 0.364 0.13 0.615 4.6e-09
UNIPROTKB|Q29RS1300 HSD17B13 "Hydroxysteroid (17-b 0.364 0.13 0.615 5.9e-09
UNIPROTKB|F1RW28300 HSD17B13 "Uncharacterized prot 0.364 0.13 0.589 1.6e-08
RGD|1359553300 Hsd17b13 "hydroxysteroid (17-b 0.373 0.133 0.55 3.5e-08
UNIPROTKB|Q5M875300 Hsd17b13 "17-beta-hydroxystero 0.373 0.133 0.55 3.5e-08
UNIPROTKB|Q7Z5P4 HSD17B13 "17-beta-hydroxysteroid dehydrogenase 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 150 (57.9 bits), Expect = 2.7e-10, P = 2.7e-10
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query:    38 EAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFA 76
             +A LPSM+ERNHGH+V ++S+CG  G+P ++PYCSSKFA
Sbjct:   153 KALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFA 191




GO:0000166 "nucleotide binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
FB|FBgn0029994 CG2254 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2049 sdr16c5a "short chain dehydrogenase/reductase family 16C, member 5a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0032405 CG14946 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUP9 SDR16C5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ96 HSD17B13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RS1 HSD17B13 "Hydroxysteroid (17-beta) dehydrogenase 13" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RW28 HSD17B13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1359553 Hsd17b13 "hydroxysteroid (17-beta) dehydrogenase 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M875 Hsd17b13 "17-beta-hydroxysteroid dehydrogenase 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 9e-14
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 7e-12
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-11
cd05233234 cd05233, SDR_c, classical (c) SDRs 5e-11
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 6e-11
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 1e-10
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 1e-08
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 3e-08
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 4e-08
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 4e-08
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 6e-08
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 9e-08
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-07
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 2e-07
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 2e-07
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 6e-07
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 8e-07
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 1e-06
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 6e-06
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-05
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 2e-05
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 2e-05
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 2e-05
PRK07109 334 PRK07109, PRK07109, short chain dehydrogenase; Pro 2e-05
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 3e-05
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 3e-05
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 4e-05
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 7e-05
PRK05872 296 PRK05872, PRK05872, short chain dehydrogenase; Pro 7e-05
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-05
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 9e-05
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 1e-04
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-04
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-04
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 1e-04
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 1e-04
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 1e-04
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-04
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-04
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 3e-04
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 4e-04
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 4e-04
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 5e-04
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 5e-04
COG1028251 COG1028, FabG, Dehydrogenases with different speci 0.001
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 0.001
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 0.001
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 0.001
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 0.001
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 0.001
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 0.001
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 0.001
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 0.002
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 0.002
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 0.002
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 0.002
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 0.002
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 0.003
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 0.004
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 0.004
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
 Score = 64.2 bits (157), Expect = 9e-14
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 36  TLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAV 77
           T +AFLP M+ERNHGH+V ++S+ G++    +  YC+SK A 
Sbjct: 114 TTKAFLPDMLERNHGHIVTIASVAGLISPAGLADYCASKAAA 155


17-beta-hydroxysteroid dehydrogenases (17betaHSD) are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. 17betaHSD type XI, a classical SDR, preferentially converts 3alpha-adiol to androsterone but not numerous other tested steroids. This subgroup of classical SDRs also includes members identified as retinol dehydrogenases, which convert retinol to retinal, a property that overlaps with 17betaHSD activity. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 243

>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.88
PRK08339263 short chain dehydrogenase; Provisional 99.85
KOG1610|consensus 322 99.84
KOG1205|consensus282 99.84
COG0300265 DltE Short-chain dehydrogenases of various substra 99.83
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.83
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.82
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.81
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.81
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.81
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.81
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.81
KOG1200|consensus256 99.8
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.8
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.8
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.8
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.79
KOG1201|consensus300 99.79
PRK07063260 short chain dehydrogenase; Provisional 99.79
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.79
PLN02780320 ketoreductase/ oxidoreductase 99.79
PRK12747252 short chain dehydrogenase; Provisional 99.79
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.78
PRK08303305 short chain dehydrogenase; Provisional 99.78
PRK07062265 short chain dehydrogenase; Provisional 99.78
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.77
KOG0725|consensus270 99.77
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.77
PRK08589272 short chain dehydrogenase; Validated 99.77
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.77
PRK06125259 short chain dehydrogenase; Provisional 99.76
PRK07791286 short chain dehydrogenase; Provisional 99.76
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.76
PRK06114254 short chain dehydrogenase; Provisional 99.76
PRK07478254 short chain dehydrogenase; Provisional 99.76
KOG1207|consensus245 99.76
PRK05599246 hypothetical protein; Provisional 99.76
PRK06398258 aldose dehydrogenase; Validated 99.76
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.76
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.75
PRK08277278 D-mannonate oxidoreductase; Provisional 99.75
PRK05993277 short chain dehydrogenase; Provisional 99.75
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.75
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.75
PRK07985294 oxidoreductase; Provisional 99.75
PRK06139 330 short chain dehydrogenase; Provisional 99.74
PRK05867253 short chain dehydrogenase; Provisional 99.74
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.74
PRK07831262 short chain dehydrogenase; Provisional 99.73
PRK06182273 short chain dehydrogenase; Validated 99.73
PRK08862227 short chain dehydrogenase; Provisional 99.73
PRK08340259 glucose-1-dehydrogenase; Provisional 99.73
PRK06523260 short chain dehydrogenase; Provisional 99.73
PRK07578199 short chain dehydrogenase; Provisional 99.73
PRK05884223 short chain dehydrogenase; Provisional 99.73
PRK05876275 short chain dehydrogenase; Provisional 99.73
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.73
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.73
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.73
PRK05855582 short chain dehydrogenase; Validated 99.73
PRK06484520 short chain dehydrogenase; Validated 99.72
PRK05872 296 short chain dehydrogenase; Provisional 99.72
PLN02253280 xanthoxin dehydrogenase 99.72
PRK07825273 short chain dehydrogenase; Provisional 99.72
PRK08265261 short chain dehydrogenase; Provisional 99.72
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.71
PRK06180277 short chain dehydrogenase; Provisional 99.71
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.71
PRK06128300 oxidoreductase; Provisional 99.71
PRK07035252 short chain dehydrogenase; Provisional 99.71
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.71
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.71
KOG1209|consensus289 99.71
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.71
PRK08703239 short chain dehydrogenase; Provisional 99.71
PRK06172253 short chain dehydrogenase; Provisional 99.7
PRK07677252 short chain dehydrogenase; Provisional 99.7
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.7
PRK06841255 short chain dehydrogenase; Provisional 99.7
PRK09242257 tropinone reductase; Provisional 99.7
PRK08936261 glucose-1-dehydrogenase; Provisional 99.7
PRK08643256 acetoin reductase; Validated 99.7
PRK06484 520 short chain dehydrogenase; Validated 99.7
PRK08278273 short chain dehydrogenase; Provisional 99.7
PRK05650270 short chain dehydrogenase; Provisional 99.69
PRK06483236 dihydromonapterin reductase; Provisional 99.69
PRK06179270 short chain dehydrogenase; Provisional 99.69
PRK08263275 short chain dehydrogenase; Provisional 99.69
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.68
PRK07024257 short chain dehydrogenase; Provisional 99.68
PRK07904253 short chain dehydrogenase; Provisional 99.68
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.68
PRK12743256 oxidoreductase; Provisional 99.68
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.67
PRK09009235 C factor cell-cell signaling protein; Provisional 99.67
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.67
PRK07832272 short chain dehydrogenase; Provisional 99.67
PRK07109 334 short chain dehydrogenase; Provisional 99.67
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.67
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.67
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.66
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.66
PRK07856252 short chain dehydrogenase; Provisional 99.66
PRK12742237 oxidoreductase; Provisional 99.66
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.66
PRK07102243 short chain dehydrogenase; Provisional 99.66
COG1028251 FabG Dehydrogenases with different specificities ( 99.66
PRK06940275 short chain dehydrogenase; Provisional 99.65
PRK05693274 short chain dehydrogenase; Provisional 99.65
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.65
PLN00015308 protochlorophyllide reductase 99.65
PRK08226263 short chain dehydrogenase; Provisional 99.65
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.65
PRK06482276 short chain dehydrogenase; Provisional 99.64
PRK07067257 sorbitol dehydrogenase; Provisional 99.64
PRK08267260 short chain dehydrogenase; Provisional 99.64
PRK07069251 short chain dehydrogenase; Validated 99.64
PRK09072263 short chain dehydrogenase; Provisional 99.63
PRK06101240 short chain dehydrogenase; Provisional 99.63
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.63
PRK10538248 malonic semialdehyde reductase; Provisional 99.63
PRK06924251 short chain dehydrogenase; Provisional 99.63
PRK07023243 short chain dehydrogenase; Provisional 99.63
KOG1204|consensus253 99.63
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.63
KOG1611|consensus249 99.63
PRK05866293 short chain dehydrogenase; Provisional 99.63
PRK07577234 short chain dehydrogenase; Provisional 99.62
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.62
PRK07454241 short chain dehydrogenase; Provisional 99.62
KOG1210|consensus 331 99.62
PRK06057255 short chain dehydrogenase; Provisional 99.62
PRK07576264 short chain dehydrogenase; Provisional 99.62
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.61
PRK05717255 oxidoreductase; Validated 99.61
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.61
KOG4169|consensus261 99.61
PRK12744257 short chain dehydrogenase; Provisional 99.61
PRK08628258 short chain dehydrogenase; Provisional 99.61
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.6
PRK06949258 short chain dehydrogenase; Provisional 99.6
PRK06947248 glucose-1-dehydrogenase; Provisional 99.6
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.6
PRK06123248 short chain dehydrogenase; Provisional 99.6
PRK06194287 hypothetical protein; Provisional 99.6
PRK09291257 short chain dehydrogenase; Provisional 99.6
PRK06701290 short chain dehydrogenase; Provisional 99.6
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.59
PRK08177225 short chain dehydrogenase; Provisional 99.59
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.59
PRK07201657 short chain dehydrogenase; Provisional 99.58
PRK06196315 oxidoreductase; Provisional 99.58
PRK07890258 short chain dehydrogenase; Provisional 99.58
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.58
PRK06914280 short chain dehydrogenase; Provisional 99.58
PRK06500249 short chain dehydrogenase; Provisional 99.58
PRK09186256 flagellin modification protein A; Provisional 99.58
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.58
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.57
PRK06138252 short chain dehydrogenase; Provisional 99.57
PRK12939250 short chain dehydrogenase; Provisional 99.57
PRK12827249 short chain dehydrogenase; Provisional 99.57
PRK08251248 short chain dehydrogenase; Provisional 99.56
PRK12937245 short chain dehydrogenase; Provisional 99.56
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.56
PRK07814263 short chain dehydrogenase; Provisional 99.56
PRK05875276 short chain dehydrogenase; Provisional 99.56
PRK06198260 short chain dehydrogenase; Provisional 99.56
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.55
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
KOG1014|consensus312 99.55
PRK07775274 short chain dehydrogenase; Provisional 99.55
PRK08017256 oxidoreductase; Provisional 99.55
PRK07060245 short chain dehydrogenase; Provisional 99.54
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.54
PRK07774250 short chain dehydrogenase; Provisional 99.54
PRK09134258 short chain dehydrogenase; Provisional 99.54
PRK05854313 short chain dehydrogenase; Provisional 99.53
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.53
PRK12746254 short chain dehydrogenase; Provisional 99.52
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.52
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.51
PRK06197306 short chain dehydrogenase; Provisional 99.51
PRK08264238 short chain dehydrogenase; Validated 99.51
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.5
PRK06181263 short chain dehydrogenase; Provisional 99.5
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.48
PRK07074257 short chain dehydrogenase; Provisional 99.48
PRK07326237 short chain dehydrogenase; Provisional 99.48
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.47
PRK08324681 short chain dehydrogenase; Validated 99.45
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.45
PRK07041230 short chain dehydrogenase; Provisional 99.44
PRK12828239 short chain dehydrogenase; Provisional 99.43
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.43
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.42
PRK06953222 short chain dehydrogenase; Provisional 99.41
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.41
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.4
PRK12367245 short chain dehydrogenase; Provisional 99.39
PRK12829264 short chain dehydrogenase; Provisional 99.38
KOG1199|consensus260 99.33
KOG1208|consensus314 99.31
PRK08219227 short chain dehydrogenase; Provisional 99.3
PRK09135249 pteridine reductase; Provisional 99.29
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.27
PRK07806248 short chain dehydrogenase; Provisional 99.23
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.13
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.02
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.96
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.79
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.77
KOG1478|consensus 341 98.68
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.48
PLN03209 576 translocon at the inner envelope of chloroplast su 97.99
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.97
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 97.97
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.79
PLN02583297 cinnamoyl-CoA reductase 97.79
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 97.73
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 97.39
PLN02650 351 dihydroflavonol-4-reductase 97.37
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 97.34
PLN00198 338 anthocyanidin reductase; Provisional 97.31
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 97.2
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 97.03
KOG4022|consensus236 96.96
PLN02653 340 GDP-mannose 4,6-dehydratase 96.93
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.72
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.69
PLN02214 342 cinnamoyl-CoA reductase 96.53
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.53
TIGR01746 367 Thioester-redct thioester reductase domain. It has 96.5
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 96.49
PLN02572 442 UDP-sulfoquinovose synthase 96.34
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 96.05
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 95.94
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 95.91
PLN02240 352 UDP-glucose 4-epimerase 95.89
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 95.84
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 95.49
PRK10675 338 UDP-galactose-4-epimerase; Provisional 95.4
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 95.34
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 94.86
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 94.75
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 94.7
PLN02686 367 cinnamoyl-CoA reductase 94.58
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 93.64
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 93.38
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 93.07
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 92.98
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 92.94
PLN02206 442 UDP-glucuronate decarboxylase 92.66
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 92.53
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 91.91
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 91.58
PLN02695 370 GDP-D-mannose-3',5'-epimerase 91.3
PLN02427 386 UDP-apiose/xylose synthase 91.2
PLN02166 436 dTDP-glucose 4,6-dehydratase 90.03
PLN02260 668 probable rhamnose biosynthetic enzyme 89.33
PLN02996 491 fatty acyl-CoA reductase 89.07
KOG1502|consensus 327 88.76
COG3320 382 Putative dehydrogenase domain of multifunctional n 87.82
PRK07201 657 short chain dehydrogenase; Provisional 86.0
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 80.23
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
Probab=99.88  E-value=6e-22  Score=134.39  Aligned_cols=94  Identities=19%  Similarity=0.175  Sum_probs=89.9

Q ss_pred             CCCccccccHHHHHHHhhhhhhhhhHhhhHHHHHHHhHHHHccCCcEEEEEcCCccccCCCCCcccHHHHHHHHHHHHHH
Q psy1073           5 PYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIY   84 (107)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~vn~~g~~~~~~~~~~~~~l~~~~~~~~g~iv~iss~~~~~~~~~~~~y~~sK~a~~~~~~~l   84 (107)
                      +..+..+.+.++|++++++|+.|.+     +.+++++|.|.+++.|.|||+||..|..++|+...|+++|+++.+|++.|
T Consensus        93 ~g~~~~~~~~~dw~~Mid~Ni~G~l-----~~~~avLP~m~~r~~G~IiN~~SiAG~~~y~~~~vY~ATK~aV~~fs~~L  167 (246)
T COG4221          93 LGDPLDEADLDDWDRMIDTNVKGLL-----NGTRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVYGATKAAVRAFSLGL  167 (246)
T ss_pred             cCChhhhCCHHHHHHHHHHHHHHHH-----HHHHHhhhHHHhcCCceEEEeccccccccCCCCccchhhHHHHHHHHHHH
Confidence            3467778899999999999999999     99999999999999999999999999999999999999999999999999


Q ss_pred             HHhhccCCCeEEEeeccee
Q psy1073          85 LGSWERTEMNYLFLAHCIT  103 (107)
Q Consensus        85 ~~~~~~~gi~v~~i~P~~~  103 (107)
                      ++|+..++|||..|.||.+
T Consensus       168 R~e~~g~~IRVt~I~PG~v  186 (246)
T COG4221         168 RQELAGTGIRVTVISPGLV  186 (246)
T ss_pred             HHHhcCCCeeEEEecCcee
Confidence            9999999999999999977



>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 1e-07
1fds_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 3e-05
1fdw_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 3e-05
1fdu_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 3e-05
1iol_A 327 Estrogenic 17-beta Hydroxysteroid Dehydrogenase Com 3e-05
1equ_A 327 Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin 3e-05
1a27_A289 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 3e-05
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 6e-04
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 5/70 (7%) Query: 36 TLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYLGSWERTEMNY 95 T +AFLP+M + NHGH+V ++S G + +P ++ YCSSKFA H E+ Sbjct: 146 TTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLT-----DELAA 200 Query: 96 LFLAHCITTC 105 L + TTC Sbjct: 201 LQITGVKTTC 210
>pdb|1FDS|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Complexed With 17- Beta-Estradiol Length = 327 Back     alignment and structure
>pdb|1FDW|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221q Complexed With Estradiol Length = 327 Back     alignment and structure
>pdb|1FDU|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221l Complexed With Estradiol And Nadp+ Length = 327 Back     alignment and structure
>pdb|1IOL|A Chain A, Estrogenic 17-beta Hydroxysteroid Dehydrogenase Complexed 17-beta- Estradiol Length = 327 Back     alignment and structure
>pdb|1EQU|A Chain A, Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin Complexed With Nadp+ Length = 327 Back     alignment and structure
>pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 4e-20
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 2e-12
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 3e-12
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 4e-12
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 4e-12
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 1e-11
3tjr_A301 Short chain dehydrogenase; structural genomics, se 1e-11
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 3e-11
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 3e-11
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 4e-11
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 3e-10
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 5e-10
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 5e-10
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 5e-10
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 8e-10
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 1e-09
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-09
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 4e-09
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 8e-09
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 8e-09
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 1e-08
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 2e-08
1nff_A260 Putative oxidoreductase RV2002; directed evolution 2e-08
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-08
3tsc_A277 Putative oxidoreductase; structural genomics, seat 2e-08
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-08
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 3e-08
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 3e-08
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 3e-08
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 3e-08
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 4e-08
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 4e-08
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 5e-08
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 6e-08
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 8e-08
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 1e-07
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 1e-07
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 1e-07
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 1e-07
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 1e-07
4dqx_A277 Probable oxidoreductase protein; structural genomi 1e-07
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 1e-07
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 1e-07
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 1e-07
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 2e-07
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-07
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-07
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 2e-07
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 3e-07
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 4e-07
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 4e-07
3cxt_A291 Dehydrogenase with different specificities; rossma 4e-07
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 4e-07
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 5e-07
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 6e-07
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 6e-07
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 6e-07
1xq1_A266 Putative tropinone reducatse; structural genomics, 7e-07
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 7e-07
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 9e-07
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-06
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 1e-06
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 1e-06
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 2e-06
4e4y_A244 Short chain dehydrogenase family protein; structur 2e-06
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 2e-06
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 3e-06
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 3e-06
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 3e-06
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 3e-06
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 4e-06
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 5e-06
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 5e-06
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 6e-06
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 6e-06
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 6e-06
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 6e-06
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 6e-06
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 7e-06
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 7e-06
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 7e-06
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 7e-06
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 1e-05
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 1e-05
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 1e-05
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 1e-05
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 2e-05
3imf_A257 Short chain dehydrogenase; structural genomics, in 2e-05
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 2e-05
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-05
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 2e-05
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 2e-05
4eso_A255 Putative oxidoreductase; NADP, structural genomics 3e-05
3tox_A280 Short chain dehydrogenase; structural genomics, PS 5e-05
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 5e-05
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 5e-05
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 5e-05
3e03_A274 Short chain dehydrogenase; structural genomics, PS 6e-05
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 6e-05
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 7e-05
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 7e-05
3gem_A260 Short chain dehydrogenase; structural genomics, AP 1e-04
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 1e-04
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 1e-04
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 2e-04
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 2e-04
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 2e-04
1spx_A278 Short-chain reductase family member (5L265); paral 3e-04
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 3e-04
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 3e-04
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 4e-04
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 5e-04
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 5e-04
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 7e-04
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 8e-04
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
 Score = 80.8 bits (200), Expect = 4e-20
 Identities = 21/43 (48%), Positives = 31/43 (72%)

Query: 36  TLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVR 78
           T +AFLP+M + NHGH+V ++S  G + +P ++ YCSSKFA  
Sbjct: 146 TTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAV 188


>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.94
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.93
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.92
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.92
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.91
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.9
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.9
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.9
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.85
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.85
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.85
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.85
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.85
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.85
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.84
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.84
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.84
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.84
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.84
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.84
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.84
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.84
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.84
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.84
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.84
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.84
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.84
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.84
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.84
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.84
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.84
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.84
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.84
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.84
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.83
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.83
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.83
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.83
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.83
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.83
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.83
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.83
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.83
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.83
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.83
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.83
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.83
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.83
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.82
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.82
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.82
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.82
3rih_A293 Short chain dehydrogenase or reductase; structural 99.82
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.82
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.82
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.82
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.82
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.82
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.82
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.82
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.82
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.82
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.82
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.82
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.82
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.82
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.82
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.82
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.81
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.81
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.81
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.81
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.81
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.81
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.81
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.81
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.81
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.81
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.81
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.81
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.81
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.81
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.81
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.81
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.81
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.81
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.8
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.8
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.8
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.8
4e4y_A244 Short chain dehydrogenase family protein; structur 99.8
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.8
3cxt_A291 Dehydrogenase with different specificities; rossma 99.8
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.8
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.8
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.8
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.8
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.8
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.8
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.8
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.8
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.8
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.8
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.8
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.8
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.8
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.8
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.8
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.79
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.79
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.79
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.79
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.79
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.79
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.79
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.79
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.79
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.79
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.79
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.79
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.79
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.79
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.78
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.78
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.78
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.78
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.78
1xkq_A280 Short-chain reductase family member (5D234); parra 99.78
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.78
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.78
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.78
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.78
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.78
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.78
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.78
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.78
1spx_A278 Short-chain reductase family member (5L265); paral 99.78
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.77
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.77
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.77
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.77
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.77
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.77
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.77
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.77
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.77
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.77
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.77
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.76
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.76
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.76
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.76
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.76
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.76
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.76
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.76
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.76
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.76
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.76
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.75
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.75
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.75
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.75
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.75
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.75
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.75
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.75
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.75
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.74
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.74
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.74
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.74
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.74
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.73
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.73
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.73
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.73
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.73
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.73
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.72
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.72
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.72
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.72
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.72
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.72
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.72
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.72
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.71
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.71
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.71
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.71
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.71
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.71
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.7
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.7
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.69
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.69
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.69
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.69
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.68
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.68
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.68
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.67
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.67
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.67
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.66
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.66
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.66
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.64
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.63
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.62
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.59
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.54
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.49
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.48
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.44
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.41
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.34
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.33
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.32
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.17
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.97
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 98.9
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.86
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.82
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 98.68
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.65
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.64
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.63
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 98.6
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.6
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.59
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 98.58
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.56
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.55
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.46
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 98.43
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 98.42
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 98.4
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 98.39
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 98.37
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.36
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 98.35
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.3
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 98.29
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.27
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.23
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.18
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 98.17
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.16
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 98.16
4f6c_A 427 AUSA reductase domain protein; thioester reductase 98.12
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 98.1
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.1
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 98.09
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 98.09
1xq6_A253 Unknown protein; structural genomics, protein stru 98.09
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 98.05
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.05
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 98.02
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.99
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 97.99
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.97
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 97.96
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 97.95
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 97.92
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 97.92
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 97.91
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 97.91
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.9
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.9
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 97.89
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.87
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 97.86
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 97.84
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.83
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.83
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 97.77
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 97.76
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.76
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 97.75
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.73
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 97.69
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.6
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 97.6
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 97.56
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 97.55
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.52
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.51
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.47
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.44
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 97.36
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 97.29
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.28
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 97.13
4f6l_B 508 AUSA reductase domain protein; thioester reductase 97.12
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.1
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 97.01
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.91
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 96.66
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.39
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 96.26
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.22
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 96.22
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.89
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 95.65
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 93.27
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 87.23
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=99.94  E-value=2.8e-26  Score=157.18  Aligned_cols=97  Identities=16%  Similarity=0.190  Sum_probs=92.4

Q ss_pred             CCccccccHHHHHHHhhhhhhhhhHhhhHHHHHHHhHHHHccCCcEEEEEcCCccccCCCCCcccHHHHHHHHHHHHHHH
Q psy1073           6 YVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNIYL   85 (107)
Q Consensus         6 ~~~~~~~~~~~~~~~~~vn~~g~~~~~~~~~~~~~l~~~~~~~~g~iv~iss~~~~~~~~~~~~y~~sK~a~~~~~~~l~   85 (107)
                      ..++++.++++|++++++|+.|++     +++|+++|+|+++++|+||++||..+..+.++..+|+++|+|+.+|+|+++
T Consensus        98 ~~~~~~~~~e~~~~~~~vNl~g~~-----~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asKaal~~ltr~lA  172 (254)
T 4fn4_A           98 VTPVAEVSDELWERVLAVNLYSAF-----YSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIA  172 (254)
T ss_dssp             TCCGGGCCHHHHHHHHHHHTHHHH-----HHHHHHHHHHHHHTCEEEEEECCGGGTCSSSSCHHHHHHHHHHHHHHHHHH
T ss_pred             CCChhhCCHHHHHHHHHHHhHHHH-----HHHHHHHHHHHHcCCcEEEEEechhhcCCCCCChHHHHHHHHHHHHHHHHH
Confidence            356889999999999999999999     899999999999889999999999999999999999999999999999999


Q ss_pred             HhhccCCCeEEEeecceeecCC
Q psy1073          86 GSWERTEMNYLFLAHCITTCNW  107 (107)
Q Consensus        86 ~~~~~~gi~v~~i~P~~~~~~~  107 (107)
                      .|++++|||||.|+||.+.||.
T Consensus       173 ~ela~~gIrVN~V~PG~i~T~~  194 (254)
T 4fn4_A          173 AHYGDQGIRAVAVLPGTVKTNI  194 (254)
T ss_dssp             HHHGGGTEEEEEEEECSBCSSC
T ss_pred             HHhhhhCeEEEEEEeCCCCCcc
Confidence            9999999999999999998873



>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 1e-08
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-07
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 3e-07
d1gz6a_ 302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 7e-07
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-06
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 6e-06
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 8e-06
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-05
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 5e-05
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 3e-04
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 5e-04
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 5e-04
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 7e-04
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 8e-04
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 9e-04
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: 17-beta-hydroxysteroid dehydrogenase type XI
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.4 bits (115), Expect = 1e-08
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 39  AFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVR 78
           AFLP+M + NHGH+V ++S  G + +P ++ YCSSKFA  
Sbjct: 125 AFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAV 164


>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.92
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.92
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.92
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.92
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.91
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.91
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.91
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.91
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.91
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.91
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.91
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.91
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.91
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.9
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.9
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.9
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.9
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.9
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.9
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.89
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.89
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.89
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.89
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.89
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.89
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.89
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.88
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.88
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.88
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.88
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.88
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.88
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.87
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.87
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.87
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.87
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.87
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.86
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.86
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.85
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.85
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.84
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.83
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.83
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.82
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.82
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.82
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.82
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.81
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.8
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.79
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.79
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.78
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.77
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.75
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.75
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.71
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.71
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.71
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.65
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.61
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.53
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.51
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.4
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.38
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.35
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 96.47
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 96.42
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 96.27
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 96.09
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.97
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 95.65
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 95.4
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.39
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 94.76
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.96
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.31
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 92.88
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 92.76
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 91.42
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 89.09
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.17
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 84.16
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Bacterial sepiapterin reductase
species: Chlorobium tepidum [TaxId: 1097]
Probab=99.92  E-value=3.6e-25  Score=148.77  Aligned_cols=99  Identities=12%  Similarity=0.051  Sum_probs=93.5

Q ss_pred             CCCCccccccHHHHHHHhhhhhhhhhHhhhHHHHHHHhHHHHccCCcEEEEEcCCccccCCCCCcccHHHHHHHHHHHHH
Q psy1073           4 LPYVNDKIWLVSYYNNVYAVALFIPIIFICGETLEAFLPSMIERNHGHVVALSSMCGVLGLPNVVPYCSSKFAVREGHNI   83 (107)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~vn~~g~~~~~~~~~~~~~l~~~~~~~~g~iv~iss~~~~~~~~~~~~y~~sK~a~~~~~~~   83 (107)
                      ....++.+.+.++|++.+++|+.|++     +++|+++|.|+++++|+||++||..+..+.++...|+++|+|+.+|+++
T Consensus        96 ~~~~~~~~~~~~~~~~~~~vNl~g~~-----~~~~~~~~~m~~~~~G~Ii~isS~~~~~~~~~~~~Y~asK~al~~lt~~  170 (240)
T d2bd0a1          96 GRFGALSDLTEEDFDYTMNTNLKGTF-----FLTQALFALMERQHSGHIFFITSVAATKAFRHSSIYCMSKFGQRGLVET  170 (240)
T ss_dssp             CCCCCGGGCCHHHHHHHHHHHTHHHH-----HHHHHHHHHHHHHTCEEEEEECCGGGTSCCTTCHHHHHHHHHHHHHHHH
T ss_pred             ccCCccccCCHHHHhhcCCEeehHHH-----HHHHHHhHHHHhcCCCceEEEechhhcCCCCCChHHHHHHHHHHHHHHH
Confidence            34567888999999999999999999     7999999999998889999999999999999999999999999999999


Q ss_pred             HHHhhccCCCeEEEeecceeecCC
Q psy1073          84 YLGSWERTEMNYLFLAHCITTCNW  107 (107)
Q Consensus        84 l~~~~~~~gi~v~~i~P~~~~~~~  107 (107)
                      ++.|++++|||||.|+||.+.||+
T Consensus       171 la~el~~~gIrvn~i~PG~v~T~~  194 (240)
T d2bd0a1         171 MRLYARKCNVRITDVQPGAVYTPM  194 (240)
T ss_dssp             HHHHHTTTTEEEEEEEECCBCSTT
T ss_pred             HHHHhCcCCeEEEEeeeCcccCch
Confidence            999999999999999999998874



>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure