Diaphorina citri psyllid: psy10762


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPPK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccc
MW**GETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 84 May be involved in transcriptional regulation.confidentP51523

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010729 [BP]positive regulation of hydrogen peroxide biosynthetic processprobableGO:0010310, GO:0009889, GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031328, GO:0031323, GO:2000377, GO:0050794, GO:0010726, GO:2000379, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010728, GO:0048522
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0045931 [BP]positive regulation of mitotic cell cycleprobableGO:0007346, GO:0045787, GO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0031935 [BP]regulation of chromatin silencingprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468, GO:0060968
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901030 [BP]positive regulation of mitochondrial outer membrane permeabilizationprobableGO:0060341, GO:2001233, GO:0051049, GO:0032386, GO:0010822, GO:0048583, GO:0051128, GO:0010821, GO:0023051, GO:0010941, GO:0042981, GO:0050789, GO:0010646, GO:0009966, GO:0033043, GO:0043067, GO:0065007, GO:0048518, GO:1901028, GO:0051130, GO:0050794, GO:0008150, GO:0032879, GO:0010638, GO:0048522
GO:0030178 [BP]negative regulation of Wnt receptor signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 3-115
View the alignment between query and template
View the model in PyMOL