Psyllid ID: psy10762


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPPK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccc
ccHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccc
mwhtgetphrcdycaktftrkEHLVNHVrqhtgesphhcnycaksftrkdhmvyherqhtgetpfpcqycpkaftrkdhLVNHvrrhtgesphkctycmksftrkehltNHIRQHTvrrvndlppk
mwhtgetphrcdycAKTFTRKEHLVNHvrqhtgesphhcnYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNhvrrhtgesphkctyCMKSFTRKehltnhirqhtvrrvndlppk
MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPPK
*********RCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHI**************
MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPP*
********HRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPPK
MW**GETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVNDLPPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
P51523738 Zinc finger protein 84 OS yes N/A 0.920 0.157 0.521 2e-31
Q96RE9604 Zinc finger protein 300 O no N/A 0.904 0.188 0.5 3e-29
Q5R5Y7470 Zinc finger protein 436 O no N/A 0.904 0.242 0.491 4e-29
Q9C0F3470 Zinc finger protein 436 O no N/A 0.928 0.248 0.478 5e-29
Q15776578 Zinc finger protein 192 O no N/A 0.960 0.209 0.446 6e-29
A2T736578 Zinc finger protein 192 O no N/A 0.960 0.209 0.446 6e-29
A1YG60578 Zinc finger protein 192 O N/A N/A 0.960 0.209 0.446 6e-29
Q8BPP0452 Zinc finger protein 436 O no N/A 0.928 0.258 0.478 7e-29
P10076 861 Zinc finger protein 26 OS no N/A 0.928 0.135 0.478 2e-28
Q9Y6Q3630 Zinc finger protein 37 ho no N/A 0.904 0.180 0.482 3e-28
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function desciption
 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%)

Query: 3   HTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGE 62
           HTGE P+ C+ C K F  K  L+NH R HTGE P  C+ C K+F+RK H++ H+R HTGE
Sbjct: 621 HTGEKPYECNECRKAFREKSSLINHQRIHTGEKPFECSECGKAFSRKSHLIPHQRTHTGE 680

Query: 63  TPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRR 119
            P+ C  C KAF++K  LVNH R HTGE P++C  C K+F++K  L NH R HTV++
Sbjct: 681 KPYGCSECRKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKK 737




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=2 SV=1 Back     alignment and function description
>sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 Back     alignment and function description
>sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=2 SV=2 Back     alignment and function description
>sp|Q15776|ZN192_HUMAN Zinc finger protein 192 OS=Homo sapiens GN=ZNF192 PE=1 SV=2 Back     alignment and function description
>sp|A2T736|ZN192_PANTR Zinc finger protein 192 OS=Pan troglodytes GN=ZNF192 PE=3 SV=1 Back     alignment and function description
>sp|A1YG60|ZN192_PANPA Zinc finger protein 192 OS=Pan paniscus GN=ZNF192 PE=3 SV=1 Back     alignment and function description
>sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
328720798 632 PREDICTED: zinc finger protein 84-like [ 0.666 0.132 0.965 1e-60
383857871 1127 PREDICTED: zinc finger protein 256-like 0.888 0.099 0.862 2e-55
350398052 1083 PREDICTED: zinc finger protein 268-like 0.888 0.103 0.862 4e-55
340720923 1084 PREDICTED: zinc finger protein 268-like 0.888 0.103 0.862 4e-55
380028964 1083 PREDICTED: zinc finger protein 184-like 0.888 0.103 0.862 4e-55
328782115 1082 PREDICTED: zinc finger protein 268-like 0.888 0.103 0.862 5e-55
357604684 1065 putative zinc finger protein [Danaus ple 0.888 0.105 0.853 7e-55
91089385 974 PREDICTED: similar to crooked legs CG149 0.888 0.114 0.836 2e-54
332030777 1019 Zinc finger protein 84 [Acromyrmex echin 0.888 0.109 0.853 3e-54
345487808 992 PREDICTED: zinc finger protein 841 isofo 0.888 0.112 0.836 4e-53
>gi|328720798|ref|XP_001947579.2| PREDICTED: zinc finger protein 84-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/116 (96%), Positives = 114/116 (98%)

Query: 1   MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHT 60
           MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGE+PHHCNYC KSFTRKDHMVYHERQHT
Sbjct: 180 MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGETPHHCNYCPKSFTRKDHMVYHERQHT 239

Query: 61  GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHT 116
           GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYC+K FTRKEHLTNHIRQHT
Sbjct: 240 GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCLKVFTRKEHLTNHIRQHT 295




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383857871|ref|XP_003704427.1| PREDICTED: zinc finger protein 256-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350398052|ref|XP_003485072.1| PREDICTED: zinc finger protein 268-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720923|ref|XP_003398878.1| PREDICTED: zinc finger protein 268-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380028964|ref|XP_003698153.1| PREDICTED: zinc finger protein 184-like [Apis florea] Back     alignment and taxonomy information
>gi|328782115|ref|XP_392980.4| PREDICTED: zinc finger protein 268-like [Apis mellifera] Back     alignment and taxonomy information
>gi|357604684|gb|EHJ64291.1| putative zinc finger protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|91089385|ref|XP_973800.1| PREDICTED: similar to crooked legs CG14938-PA [Tribolium castaneum] gi|270012538|gb|EFA08986.1| hypothetical protein TcasGA2_TC006693 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332030777|gb|EGI70453.1| Zinc finger protein 84 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345487808|ref|XP_001606584.2| PREDICTED: zinc finger protein 841 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
FB|FBgn0020309 962 crol "crooked legs" [Drosophil 0.920 0.120 0.827 3.1e-57
UNIPROTKB|F5H630737 ZNF84 "Zinc finger protein 84" 0.928 0.158 0.521 2.5e-33
UNIPROTKB|P51523738 ZNF84 "Zinc finger protein 84" 0.928 0.158 0.521 2.5e-33
UNIPROTKB|Q5TEG9302 ZNF436 "Zinc finger protein 43 0.904 0.377 0.517 3.2e-33
UNIPROTKB|F1RI76738 F1RI76 "Uncharacterized protei 0.928 0.158 0.512 3.2e-33
UNIPROTKB|J9NXK0744 ZNF84 "Uncharacterized protein 0.920 0.155 0.525 3.3e-33
ZFIN|ZDB-GENE-030131-1529346 zgc:174574 "zgc:174574" [Danio 0.928 0.338 0.521 4.1e-33
RGD|1310584393 Zfp46 "zinc finger protein 46" 0.904 0.290 0.5 6.7e-33
UNIPROTKB|J9P0N4873 J9P0N4 "Uncharacterized protei 0.904 0.130 0.561 8.3e-33
UNIPROTKB|J9NZD8470 ZNF436 "Uncharacterized protei 0.904 0.242 0.491 1.8e-32
FB|FBgn0020309 crol "crooked legs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 595 (214.5 bits), Expect = 3.1e-57, P = 3.1e-57
 Identities = 96/116 (82%), Positives = 108/116 (93%)

Query:     1 MWHTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHT 60
             +WHTGETPHRCD+C+KTFTRKEHL+NHVRQHTGESPH C+YC K+FTRK+H+V H RQHT
Sbjct:   437 LWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHT 496

Query:    61 GETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHT 116
             GETPF C YC KAFTRKDH+VNHVR+HTGESPHKCTYC K+FTRKEHLTNH+RQHT
Sbjct:   497 GETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHT 552


GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS;IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IGI;IMP
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0045931 "positive regulation of mitotic cell cycle" evidence=IMP
GO:0030178 "negative regulation of Wnt receptor signaling pathway" evidence=IGI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0031935 "regulation of chromatin silencing" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|F5H630 ZNF84 "Zinc finger protein 84" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P51523 ZNF84 "Zinc finger protein 84" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TEG9 ZNF436 "Zinc finger protein 436" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RI76 F1RI76 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXK0 ZNF84 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1529 zgc:174574 "zgc:174574" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1310584 Zfp46 "zinc finger protein 46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0N4 J9P0N4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZD8 ZNF436 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51523ZNF84_HUMANNo assigned EC number0.52130.92060.1571yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 0.001
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.001
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 0.002
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 0.003
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 37.4 bits (86), Expect = 0.001
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 7  TPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNY--CAKSFTRKDHMVYHERQHT 60
           P  C  C  +F+R EHL  H+R HTGE P  C+Y  C KSF+R   +  H R H 
Sbjct: 32 RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHH 87


Length = 467

>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
KOG2462|consensus279 99.97
KOG2462|consensus279 99.96
KOG3576|consensus267 99.84
KOG1074|consensus 958 99.83
KOG1074|consensus958 99.76
KOG3623|consensus 1007 99.73
KOG3608|consensus 467 99.71
KOG3623|consensus1007 99.7
KOG3576|consensus267 99.68
KOG3608|consensus 467 99.65
PLN03086567 PRLI-interacting factor K; Provisional 99.52
PHA00733128 hypothetical protein 99.49
PHA0276855 hypothetical protein; Provisional 99.26
PHA00733128 hypothetical protein 99.25
PLN03086567 PRLI-interacting factor K; Provisional 99.1
PHA0276855 hypothetical protein; Provisional 99.06
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.05
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.88
KOG3993|consensus500 98.84
KOG3993|consensus 500 98.81
PHA0061644 hypothetical protein 98.81
PHA0061644 hypothetical protein 98.66
PHA0073279 hypothetical protein 98.66
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.65
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.63
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.39
PHA0073279 hypothetical protein 98.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.3
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.29
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.28
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.25
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 98.03
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.0
COG5189423 SFP1 Putative transcriptional repressor regulating 97.99
smart0035526 ZnF_C2H2 zinc finger. 97.98
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.72
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.72
COG5189423 SFP1 Putative transcriptional repressor regulating 97.66
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.58
PRK04860160 hypothetical protein; Provisional 97.56
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.51
smart0035526 ZnF_C2H2 zinc finger. 97.46
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.33
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.18
PRK04860160 hypothetical protein; Provisional 97.0
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.89
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.67
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.46
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.15
COG404965 Uncharacterized protein containing archaeal-type C 96.12
KOG4173|consensus253 96.03
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.76
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.57
KOG2231|consensus 669 95.48
KOG2893|consensus 341 95.02
KOG2785|consensus 390 94.91
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.85
COG5048 467 FOG: Zn-finger [General function prediction only] 94.48
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.48
KOG1146|consensus 1406 94.46
COG404965 Uncharacterized protein containing archaeal-type C 94.23
KOG1146|consensus1406 94.16
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 93.91
PF1371937 zinc_ribbon_5: zinc-ribbon domain 93.73
PF1371736 zinc_ribbon_4: zinc-ribbon domain 93.53
KOG2186|consensus 276 93.5
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.45
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 93.36
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 93.01
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 92.67
PF09986214 DUF2225: Uncharacterized protein conserved in bact 92.6
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.57
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.38
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.2
COG5048467 FOG: Zn-finger [General function prediction only] 92.15
KOG2231|consensus 669 92.14
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 92.0
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 91.97
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 91.8
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 91.76
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 91.63
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.75
PRK06266178 transcription initiation factor E subunit alpha; V 90.64
PRK00464154 nrdR transcriptional regulator NrdR; Validated 90.42
smart00531147 TFIIE Transcription initiation factor IIE. 90.17
COG1592166 Rubrerythrin [Energy production and conversion] 90.14
KOG4173|consensus253 90.13
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 90.05
KOG2186|consensus 276 90.04
PRK06266178 transcription initiation factor E subunit alpha; V 89.84
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 89.75
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 89.5
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 89.47
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 88.86
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 88.45
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 87.8
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 87.23
PRK04023 1121 DNA polymerase II large subunit; Validated 87.03
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 86.37
KOG3408|consensus129 85.97
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 85.65
PF14353128 CpXC: CpXC protein 85.56
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 84.84
COG4957148 Predicted transcriptional regulator [Transcription 84.16
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 83.53
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 83.31
COG1198 730 PriA Primosomal protein N' (replication factor Y) 83.17
PHA0062659 hypothetical protein 82.1
PF0879028 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IP 81.57
PTZ00448373 hypothetical protein; Provisional 81.44
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 81.08
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 80.87
KOG2482|consensus423 80.86
PF15135278 UPF0515: Uncharacterised protein UPF0515 80.29
PF1290740 zf-met2: Zinc-binding 80.27
>KOG2462|consensus Back     alignment and domain information
Probab=99.97  E-value=1.2e-30  Score=156.14  Aligned_cols=107  Identities=37%  Similarity=0.739  Sum_probs=74.7

Q ss_pred             CcceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHHHHH
Q psy10762          6 ETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVNHVR   85 (126)
Q Consensus         6 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~   85 (126)
                      ++.+.|..|+++|-+...|..|+++|.  .+++|.+||+.|...+.|+.|+++|+|||||.|+.|+++|...++|..|++
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            455666666666666666666666665  356677777777777777777777777777777777777777777777777


Q ss_pred             hhcCCCCccCcccccccCCHHHHHHHHHH
Q psy10762         86 RHTGESPHKCTYCMKSFTRKEHLTNHIRQ  114 (126)
Q Consensus        86 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  114 (126)
                      +|.+.+.|.|..|+|+|+..+.|.+|...
T Consensus       237 THS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  237 THSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            77777777777777777777777777544



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>COG4957 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF08790 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PTZ00448 hypothetical protein; Provisional Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF15135 UPF0515: Uncharacterised protein UPF0515 Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-27
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-19
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-18
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-18
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-06
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-17
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 7e-17
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-15
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 7e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-15
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-10
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-14
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-14
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-14
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-10
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 9e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-09
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-13
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-13
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 5e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-10
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 3e-10
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-10
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-07
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-06
2el5_A42 Solution Structure Of The 18th Zf-C2h2 Domain From 1e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-05
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 4e-05
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-05
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2eqw_A42 Solution Structure Of The 6th C2h2 Type Zinc Finger 1e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2en0_A42 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eps_A54 Solution Structure Of The 4th Zinc Finger Domain Of 3e-04
2epy_A42 Solution Structure Of The 10th C2h2 Type Zinc Finge 4e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2eoe_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 7e-04
2eol_A42 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2em1_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 118 bits (295), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 56/119 (47%), Positives = 80/119 (67%) Query: 3 HTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGE 62 HTGE P++C C K+F+++ +L H R HTGE P+ C C KSF++ H+ H+R HTGE Sbjct: 72 HTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGE 131 Query: 63 TPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRRVN 121 P+ C C K+F+R+D+L H R HTGE P+KC C KSF+R++ L H R HT ++ + Sbjct: 132 KPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS 190
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2EL5|A Chain A, Solution Structure Of The 18th Zf-C2h2 Domain From Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EQW|A Chain A, Solution Structure Of The 6th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 484 Length = 42 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EN0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 385- 413) Of Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EPS|A Chain A, Solution Structure Of The 4th Zinc Finger Domain Of Zinc Finger Protein 278 Length = 54 Back     alignment and structure
>pdb|2EPY|A Chain A, Solution Structure Of The 10th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EOE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 508- 540) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2EOL|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 581- 609) Of Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|2EM1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 637- 667) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-33
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-30
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-39
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-17
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-36
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-19
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-35
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-26
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-34
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-29
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-33
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-28
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-33
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-31
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-32
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-29
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-32
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-31
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-25
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-30
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-29
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-27
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-26
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-26
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-26
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-25
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-19
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-25
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-22
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 1e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 4e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  132 bits (335), Expect = 1e-40
 Identities = 55/114 (48%), Positives = 76/114 (66%)

Query: 3   HTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGE 62
           HTGE P++C  C K+F+ K+ L  H R HTGE P+ C  C KSF+++ ++  H+R HTGE
Sbjct: 44  HTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGE 103

Query: 63  TPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHT 116
            P+ C  C K+F++  HL  H R HTGE P+KC  C KSF+R+++L  H R HT
Sbjct: 104 KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHT 157


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.97
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.97
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.97
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.97
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.92
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.92
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.92
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.91
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.91
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.91
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.9
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.9
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.9
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.9
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.89
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.89
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.89
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.88
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.87
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.87
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.84
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.84
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.84
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.83
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.83
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.83
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.8
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.8
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.8
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.79
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.79
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.78
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.78
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.77
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.77
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.77
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.76
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.76
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.76
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.75
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.74
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.74
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.73
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.73
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.73
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.73
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.73
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.72
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.72
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.72
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.71
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.7
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.69
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.67
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.67
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.66
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.66
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.66
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.63
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.62
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.61
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.6
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.58
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.58
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.57
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.56
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.54
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.53
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.52
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.5
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.49
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.49
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.48
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.48
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.47
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.47
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.46
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.46
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.45
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.43
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.43
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.42
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.42
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.42
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.41
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.41
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.4
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.4
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.4
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.4
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.39
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.39
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.39
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.39
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.39
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.38
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.38
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.38
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.38
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.38
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.37
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.37
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.35
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.34
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.34
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.34
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.33
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.33
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.32
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.32
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.31
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.3
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.3
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.28
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.27
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.27
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.27
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.27
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.26
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.26
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.25
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.25
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.24
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.24
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.23
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.23
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.23
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.21
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.21
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.19
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.17
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.16
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.16
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.14
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.11
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.11
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.1
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.1
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.1
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.09
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.07
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.06
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.05
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.04
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 99.03
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.02
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.02
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 99.0
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.99
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.99
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.98
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.94
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.93
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.93
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.91
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.91
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.91
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.9
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.9
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.9
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.89
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.89
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.88
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.87
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.87
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.87
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.83
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.33
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.83
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.33
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.81
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.79
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.23
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.72
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.72
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.67
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.64
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.62
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.61
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.61
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.6
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.59
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.58
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.57
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.55
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.55
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.55
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.55
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.55
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.54
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.44
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.82
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.43
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.79
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.69
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.29
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.24
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.83
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.75
2e72_A49 POGO transposable element with ZNF domain; zinc fi 97.58
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.51
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.39
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.93
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.68
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 96.65
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.65
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.38
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 95.18
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.17
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 94.28
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 92.91
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 92.52
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 92.35
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 92.34
2k5c_A95 Uncharacterized protein PF0385; structural genomic 92.2
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.05
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 91.9
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.4
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 90.43
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 89.94
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 89.77
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 89.44
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 89.22
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 88.65
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 88.21
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 87.18
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 86.24
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 83.65
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 83.63
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 82.58
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 81.55
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 80.46
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=3.9e-32  Score=160.25  Aligned_cols=117  Identities=47%  Similarity=0.914  Sum_probs=56.0

Q ss_pred             CCCCcceeccccccccCChhHHHHHHHhhcCCCCcccCCcccccCCchHHHHHHhhhcCCCCcccCCCCCcCCChhhHHH
Q psy10762          3 HTGETPHRCDYCAKTFTRKEHLVNHVRQHTGESPHHCNYCAKSFTRKDHMVYHERQHTGETPFPCQYCPKAFTRKDHLVN   82 (126)
Q Consensus         3 ~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~   82 (126)
                      |.++++|.|..|++.|.....|..|+..|.++++|.|+.|+..|.....|..|+..|.++++|.|+.|++.|.+...|..
T Consensus        44 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  123 (190)
T 2i13_A           44 HTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRA  123 (190)
T ss_dssp             C---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHH
T ss_pred             cCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHH
Confidence            34444555555555555555555555555444445555555555444445555444444444444444444444444444


Q ss_pred             HHHhhcCCCCccCcccccccCCHHHHHHHHHHhhhcc
Q psy10762         83 HVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQHTVRR  119 (126)
Q Consensus        83 h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  119 (126)
                      |+++|.++++|.|..|++.|.....|..|+++|++++
T Consensus       124 H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~  160 (190)
T 2i13_A          124 HQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEK  160 (190)
T ss_dssp             HHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCC
T ss_pred             HHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCC
Confidence            4444444444444444444444444444444444433



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 8e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.001
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.003
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.003
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.6 bits (101), Expect = 1e-07
 Identities = 18/32 (56%), Positives = 21/32 (65%)

Query: 59 HTGETPFPCQYCPKAFTRKDHLVNHVRRHTGE 90
          H+GE P+ C  C KAF+R   LV H R HTGE
Sbjct: 2  HSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.83
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.76
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.61
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.6
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.56
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.53
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.51
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.51
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.5
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.49
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.47
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.44
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.43
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.43
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.42
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.37
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.34
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.32
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.31
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.31
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.28
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.26
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.23
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.22
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.16
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.12
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.12
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.06
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.03
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.02
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.98
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.91
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.9
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.88
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.79
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.71
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.7
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.57
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.48
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.47
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.41
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.38
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.27
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.26
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.26
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.21
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.2
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.2
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.16
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.13
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.07
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.87
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.84
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.82
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.8
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.76
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.67
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.66
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.66
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.61
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.59
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.59
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.54
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.53
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.48
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.43
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 97.42
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.39
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.38
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.37
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.26
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.24
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.23
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.07
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.05
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 97.02
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.96
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.91
d1y0jb136 U-shaped transcription factor, different fingers { 96.83
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.75
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.61
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.55
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.3
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.23
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.19
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.92
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.75
d1y0jb136 U-shaped transcription factor, different fingers { 95.71
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 95.46
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.9
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.57
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 94.56
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.99
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 93.24
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 92.91
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.99
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 91.38
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 90.43
d1fu9a_36 U-shaped transcription factor, different fingers { 89.85
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.89
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 87.92
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 86.28
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 86.22
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 85.76
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 83.96
d1twfl_46 RBP12 subunit of RNA polymerase II {Baker's yeast 83.83
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 82.88
d2dkta174 RING finger and CHY zinc finger domain-containing 82.41
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 81.66
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 80.96
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.96
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 80.68
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=3.3e-21  Score=89.77  Aligned_cols=53  Identities=38%  Similarity=0.761  Sum_probs=49.2

Q ss_pred             CCCcccCCCCCcCCChhhHHHHHHhhcCCCCccCcccccccCCHHHHHHHHHHh
Q psy10762         62 ETPFPCQYCPKAFTRKDHLVNHVRRHTGESPHKCTYCMKSFTRKEHLTNHIRQH  115 (126)
Q Consensus        62 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  115 (126)
                      ++||.| .||+.|.....|..|+++|++++||.|.+|++.|...+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            579999 59999999999999999999999999999999999999999999886



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure