Diaphorina citri psyllid: psy10771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MVRPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR
ccccccccccHHHEEEEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHccc
******LYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TILB homolog May play a crucial role in regulating cilia motility in pronephric tubules, cloaca and neural tube. May be required for establishing left-right asymmetry of the body plan; controls cell fate and convergent extension (CE) movements during gastrulation, respectively, via the Wnt and the planar cell polarity (PCP) signaling pathways. Required for the proper development of renal glomeruli and tubules.confidentQ28FY0
Protein TILB homolog Plays a role in motility of cilia.confidentO88978
Protein TILB homolog Plays a role in motility of cilia.confidentQ1RMR5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0036159 [BP]inner dynein arm assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0070286, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0060287 [BP]epithelial cilium movement involved in determination of left/right asymmetryprobableGO:0032502, GO:0007389, GO:0007017, GO:0044707, GO:0007368, GO:0009987, GO:0007018, GO:0006928, GO:0008150, GO:0032501, GO:0044763, GO:0044699, GO:0009855, GO:0009799, GO:0003341, GO:0007275, GO:0003351
GO:0044458 [BP]motile cilium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0042384, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0030317 [BP]sperm motilityprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0061458 [BP]reproductive system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0036158 [BP]outer dynein arm assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0070286, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1A9N, chain A
Confidence level:confident
Coverage over the Query: 40-97
View the alignment between query and template
View the model in PyMOL