Psyllid ID: psy10771
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 100 | ||||||
| 405953478 | 1114 | Leucine-rich repeat-containing protein 6 | 0.76 | 0.068 | 0.548 | 3e-15 | |
| 115774597 | 460 | PREDICTED: protein TILB homolog [Strongy | 0.56 | 0.121 | 0.660 | 1e-14 | |
| 313245299 | 346 | unnamed protein product [Oikopleura dioi | 0.56 | 0.161 | 0.696 | 3e-14 | |
| 313218365 | 296 | unnamed protein product [Oikopleura dioi | 0.56 | 0.189 | 0.696 | 5e-14 | |
| 313225879 | 298 | unnamed protein product [Oikopleura dioi | 0.56 | 0.187 | 0.696 | 5e-14 | |
| 350419152 | 447 | PREDICTED: leucine-rich repeat-containin | 0.53 | 0.118 | 0.716 | 5e-14 | |
| 340708838 | 449 | PREDICTED: leucine-rich repeat-containin | 0.53 | 0.118 | 0.716 | 5e-14 | |
| 221128471 | 429 | PREDICTED: protein TILB homolog [Hydra m | 0.56 | 0.130 | 0.660 | 1e-13 | |
| 196002221 | 404 | hypothetical protein TRIADDRAFT_22994 [T | 0.56 | 0.138 | 0.660 | 4e-13 | |
| 226479220 | 162 | Protein phosphatase 1 regulatory subunit | 0.56 | 0.345 | 0.625 | 5e-13 |
| >gi|405953478|gb|EKC21133.1| Leucine-rich repeat-containing protein 6 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
Score = 85.5 bits (210), Expect = 3e-15, Method: Compositional matrix adjust.
Identities = 45/82 (54%), Positives = 58/82 (70%), Gaps = 6/82 (7%)
Query: 22 VKNRIISFVKLKKLSL-----FWTT-VSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIE 75
+ R SF L S+ F ++ V+EDLVRKRAEHN+ EI TLEEI+LHQ+ IEKIE
Sbjct: 633 IATRGKSFTNLNAFSIPIFHAFQSSGVTEDLVRKRAEHNNLEISTLEEISLHQQDIEKIE 692
Query: 76 ALDKWCKHLRILLLHSNIISKL 97
LD+WC+ L+IL L SN+I K+
Sbjct: 693 NLDRWCRDLKILYLQSNLIPKI 714
|
Source: Crassostrea gigas Species: Crassostrea gigas Genus: Crassostrea Family: Ostreidae Order: Ostreoida Class: Bivalvia Phylum: Mollusca Superkingdom: Eukaryota |
| >gi|115774597|ref|XP_791802.2| PREDICTED: protein TILB homolog [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|313245299|emb|CBY40071.1| unnamed protein product [Oikopleura dioica] | Back alignment and taxonomy information |
|---|
| >gi|313218365|emb|CBY41595.1| unnamed protein product [Oikopleura dioica] | Back alignment and taxonomy information |
|---|
| >gi|313225879|emb|CBY21022.1| unnamed protein product [Oikopleura dioica] | Back alignment and taxonomy information |
|---|
| >gi|350419152|ref|XP_003492089.1| PREDICTED: leucine-rich repeat-containing protein 6-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340708838|ref|XP_003393026.1| PREDICTED: leucine-rich repeat-containing protein 6-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|221128471|ref|XP_002157387.1| PREDICTED: protein TILB homolog [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|196002221|ref|XP_002110978.1| hypothetical protein TRIADDRAFT_22994 [Trichoplax adhaerens] gi|190586929|gb|EDV26982.1| hypothetical protein TRIADDRAFT_22994, partial [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
| >gi|226479220|emb|CAX73105.1| Protein phosphatase 1 regulatory subunit 7 [Schistosoma japonicum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 100 | ||||||
| UNIPROTKB|F1NUJ0 | 476 | LRRC6 "Uncharacterized protein | 0.57 | 0.119 | 0.631 | 1.3e-14 | |
| FB|FBgn0014395 | 395 | tilB "touch insensitive larva | 0.56 | 0.141 | 0.589 | 1.3e-13 | |
| RGD|1559937 | 306 | Lrrc6 "leucine rich repeat con | 0.56 | 0.183 | 0.517 | 4.3e-13 | |
| ZFIN|ZDB-GENE-040827-2 | 440 | lrrc6 "leucine rich repeat con | 0.56 | 0.127 | 0.553 | 4.7e-13 | |
| UNIPROTKB|Q86X45 | 466 | LRRC6 "Protein TILB homolog" [ | 0.56 | 0.120 | 0.535 | 6.8e-13 | |
| UNIPROTKB|Q1RMR5 | 472 | LRRC6 "Protein TILB homolog" [ | 0.56 | 0.118 | 0.535 | 7e-13 | |
| MGI|MGI:1859553 | 473 | Lrrc6 "leucine rich repeat con | 0.56 | 0.118 | 0.535 | 7e-13 | |
| UNIPROTKB|F1RRU0 | 472 | LRRC6 "Uncharacterized protein | 0.56 | 0.118 | 0.535 | 1.5e-12 | |
| UNIPROTKB|Q9NJE9 | 383 | lrrc6 "Protein TILB homolog" [ | 0.56 | 0.146 | 0.464 | 8e-09 |
| UNIPROTKB|F1NUJ0 LRRC6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 194 (73.4 bits), Expect = 1.3e-14, P = 1.3e-14
Identities = 36/57 (63%), Positives = 49/57 (85%)
Query: 41 TVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL 97
+V+EDLVR+RAEHN+ EI +LEEI+LHQ+ IEK+E LDKWC+ L+IL L +N+I K+
Sbjct: 3 SVTEDLVRRRAEHNNCEIFSLEEISLHQQEIEKLEYLDKWCRDLKILYLQNNLIPKI 59
|
|
| FB|FBgn0014395 tilB "touch insensitive larva B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|1559937 Lrrc6 "leucine rich repeat containing 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040827-2 lrrc6 "leucine rich repeat containing 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86X45 LRRC6 "Protein TILB homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1RMR5 LRRC6 "Protein TILB homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1859553 Lrrc6 "leucine rich repeat containing 6 (testis)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RRU0 LRRC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NJE9 lrrc6 "Protein TILB homolog" [Trypanosoma brucei brucei (taxid:5702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.87 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.54 | |
| KOG0531|consensus | 414 | 96.64 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.17 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 96.1 | |
| KOG1644|consensus | 233 | 95.18 | ||
| KOG2123|consensus | 388 | 94.52 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 93.07 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 92.93 | |
| KOG0531|consensus | 414 | 90.7 | ||
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 89.1 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 88.71 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 83.97 | |
| KOG4194|consensus | 873 | 82.67 | ||
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 81.51 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 81.51 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 80.17 |
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
Probab=98.87 E-value=3.4e-10 Score=83.39 Aligned_cols=59 Identities=27% Similarity=0.384 Sum_probs=12.8
Q ss_pred hhHHhHHHHHhhcccccccccchhhhhcchhhhhhHhhHHHhcchhhhhhhccCCcccccC
Q psy10771 39 WTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGK 99 (100)
Q Consensus 39 MvrIT~eLIRKraEHNe~~L~tLEElsLHQq~IEkIE~L~~~CRnLkILYLQNNlIskIEN 99 (100)
|||+|.|+|++.+.+++.. .+.|++|+.-.|.+||.++..+.+|+.|+|++|.|++||+
T Consensus 1 ~~~lt~~~i~~~~~~~n~~--~~~~L~L~~n~I~~Ie~L~~~l~~L~~L~Ls~N~I~~l~~ 59 (175)
T PF14580_consen 1 MVRLTANMIEQIAQYNNPV--KLRELNLRGNQISTIENLGATLDKLEVLDLSNNQITKLEG 59 (175)
T ss_dssp -------------------------------------S--TT-TT--EEE-TTS--S--TT
T ss_pred Ccccccccccccccccccc--ccccccccccccccccchhhhhcCCCEEECCCCCCccccC
Confidence 8999999999999999987 7899999999999999999778999999999999999986
|
|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 100 | |||
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 6e-09 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-06 |
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
Score = 49.7 bits (119), Expect = 6e-09
Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%)
Query: 41 TVSEDLVRKRAEHNDKEIGTLEEIALHQEH--IEKIEALDKWCKHLRILLLHSNIISKL 97
T +D +R E E++ LH IEK++A K + L L +N I K+
Sbjct: 5 TTIKDAIRIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKI 63
|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.91 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 92.92 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.78 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 92.68 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 92.3 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 91.92 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 91.77 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 91.68 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 91.52 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 91.5 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 91.24 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 90.8 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 90.7 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 90.42 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 90.34 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 90.11 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 89.73 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 89.52 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 89.41 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 89.15 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 89.13 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 88.67 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 88.53 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 88.39 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 88.2 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 88.0 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 87.99 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 87.96 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 87.46 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 87.31 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 87.17 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 86.88 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 86.48 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 86.46 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 86.24 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 86.13 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 85.94 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 85.91 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 85.88 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 85.73 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 85.57 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 85.29 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 85.27 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 84.92 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 84.72 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 84.71 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 84.39 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 84.22 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 84.22 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 84.11 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 83.81 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 83.72 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 83.57 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 83.5 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 83.27 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 83.14 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 83.07 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 82.92 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 82.9 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 82.75 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 82.75 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 82.43 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 82.19 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 82.13 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 81.85 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 81.84 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 81.74 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 81.53 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 81.2 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 81.17 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 81.04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 80.81 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 80.57 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 80.5 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 80.48 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 80.35 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 80.22 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 80.14 |
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
Probab=97.91 E-value=7.6e-07 Score=58.86 Aligned_cols=57 Identities=21% Similarity=0.236 Sum_probs=47.2
Q ss_pred hhHHhHHHHHhhcccccccccchhhhhcchhhhhhHhhHHHhcchhhhhhhccCCcccc
Q psy10771 39 WTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL 97 (100)
Q Consensus 39 MvrIT~eLIRKraEHNe~~L~tLEElsLHQq~IEkIE~L~~~CRnLkILYLQNNlIskI 97 (100)
|+++|.++|++.+..- -..+|++++|+.-.|..|+.+...+++|+.|+|++|.|+.+
T Consensus 1 m~~lt~~~i~~~~~~~--~~~~L~~L~l~~n~l~~i~~~~~~~~~L~~L~Ls~N~l~~~ 57 (176)
T 1a9n_A 1 MVKLTAELIEQAAQYT--NAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKL 57 (176)
T ss_dssp -CCCCHHHHHTSCEEE--CTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEE
T ss_pred CccccHHHHHHHHhcC--CcCCceEEEeeCCCCchhHHhhhcCCCCCEEECCCCCCCcc
Confidence 8999999999876543 36789999999999998888887777999999999988765
|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.18 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.61 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 95.97 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 95.79 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 95.21 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 95.14 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.07 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.06 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.0 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 94.97 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 94.39 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.34 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 93.76 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 93.52 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 92.77 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 91.69 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 90.27 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 90.14 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 90.12 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 86.96 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 83.7 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 83.22 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 83.03 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 82.74 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 82.54 |
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: U2A'-like domain: Splicesomal U2A' protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.18 E-value=5.5e-08 Score=64.69 Aligned_cols=58 Identities=21% Similarity=0.240 Sum_probs=50.1
Q ss_pred hHHhHHHHHhhcccccccccchhhhhcchhhhhhHhhHHHhcchhhhhhhccCCcccccC
Q psy10771 40 TTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGK 99 (100)
Q Consensus 40 vrIT~eLIRKraEHNe~~L~tLEElsLHQq~IEkIE~L~~~CRnLkILYLQNNlIskIEN 99 (100)
||+|.++|.+.....+ ..++.|++|+.-.|..|+.+...|++|++|+|++|.|+.+++
T Consensus 1 ~rLt~~~i~~~~~~~n--~~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~ 58 (162)
T d1a9na_ 1 VKLTAELIEQAAQYTN--AVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDG 58 (162)
T ss_dssp CCCCHHHHHTSCEEEC--TTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECC
T ss_pred CCCCHHHHhhhHhccC--cCcCcEEECCCCCCCccCccccccccCCEEECCCCCCCccCC
Confidence 6899999998876653 337899999999999999888789999999999999998864
|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|