Psyllid ID: psy10771


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MVRPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR
ccccccccccHHHEEEEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHccc
cccccccccHHHHHEHEEEcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mvrpknlyrhselYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR
mvrpknlyrhseLYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLlhsniisklgkr
MVRPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR
******LYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIIS*****
*******YRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL***
MVRPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR
**RPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGK*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRPKNLYRHSELYMYRIIHPVKNRIISFVKLKKLSLFWTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
Q28FY0 470 Protein TILB homolog OS=X yes N/A 0.56 0.119 0.607 3e-14
Q9VR52 395 Protein TILB OS=Drosophil yes N/A 0.56 0.141 0.589 1e-12
B3DH20 440 Protein TILB homolog OS=D yes N/A 0.56 0.127 0.553 1e-12
Q1RMR5 472 Protein TILB homolog OS=B yes N/A 0.56 0.118 0.535 3e-12
O88978 473 Protein TILB homolog OS=M yes N/A 0.56 0.118 0.535 4e-12
Q86X45 466 Protein TILB homolog OS=H yes N/A 0.56 0.120 0.535 4e-12
Q4R3F0 466 Protein TILB homolog OS=M N/A N/A 0.56 0.120 0.535 4e-12
Q9NJE9 383 Protein TILB homolog OS=T N/A N/A 0.56 0.146 0.464 5e-08
>sp|Q28FY0|TILB_XENTR Protein TILB homolog OS=Xenopus tropicalis GN=lrrc6 PE=2 SV=1 Back     alignment and function desciption
 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 48/56 (85%)

Query: 42 VSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL 97
          VSEDL+R+RAEHN+ EI +LEEI+LHQ+ +E+IE +DKWC+ L+IL L +N+I K+
Sbjct: 4  VSEDLIRRRAEHNNCEIFSLEEISLHQQDLERIEYIDKWCRELKILYLQNNLIGKI 59




May play a crucial role in regulating cilia motility in pronephric tubules, cloaca and neural tube. May be required for establishing left-right asymmetry of the body plan; controls cell fate and convergent extension (CE) movements during gastrulation, respectively, via the Wnt and the planar cell polarity (PCP) signaling pathways. Required for the proper development of renal glomeruli and tubules.
Xenopus tropicalis (taxid: 8364)
>sp|Q9VR52|TILB_DROME Protein TILB OS=Drosophila melanogaster GN=tilB PE=1 SV=1 Back     alignment and function description
>sp|B3DH20|TILB_DANRE Protein TILB homolog OS=Danio rerio GN=lrrc6 PE=1 SV=1 Back     alignment and function description
>sp|Q1RMR5|TILB_BOVIN Protein TILB homolog OS=Bos taurus GN=LRRC6 PE=2 SV=1 Back     alignment and function description
>sp|O88978|TILB_MOUSE Protein TILB homolog OS=Mus musculus GN=Lrrc6 PE=1 SV=1 Back     alignment and function description
>sp|Q86X45|TILB_HUMAN Protein TILB homolog OS=Homo sapiens GN=LRRC6 PE=1 SV=3 Back     alignment and function description
>sp|Q4R3F0|TILB_MACFA Protein TILB homolog OS=Macaca fascicularis GN=LRCC6 PE=2 SV=1 Back     alignment and function description
>sp|Q9NJE9|TILB_TRYBB Protein TILB homolog OS=Trypanosoma brucei brucei GN=lrrc6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
405953478 1114 Leucine-rich repeat-containing protein 6 0.76 0.068 0.548 3e-15
115774597 460 PREDICTED: protein TILB homolog [Strongy 0.56 0.121 0.660 1e-14
313245299 346 unnamed protein product [Oikopleura dioi 0.56 0.161 0.696 3e-14
313218365 296 unnamed protein product [Oikopleura dioi 0.56 0.189 0.696 5e-14
313225879 298 unnamed protein product [Oikopleura dioi 0.56 0.187 0.696 5e-14
350419152 447 PREDICTED: leucine-rich repeat-containin 0.53 0.118 0.716 5e-14
340708838 449 PREDICTED: leucine-rich repeat-containin 0.53 0.118 0.716 5e-14
221128471 429 PREDICTED: protein TILB homolog [Hydra m 0.56 0.130 0.660 1e-13
196002221 404 hypothetical protein TRIADDRAFT_22994 [T 0.56 0.138 0.660 4e-13
226479220162 Protein phosphatase 1 regulatory subunit 0.56 0.345 0.625 5e-13
>gi|405953478|gb|EKC21133.1| Leucine-rich repeat-containing protein 6 [Crassostrea gigas] Back     alignment and taxonomy information
 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/82 (54%), Positives = 58/82 (70%), Gaps = 6/82 (7%)

Query: 22  VKNRIISFVKLKKLSL-----FWTT-VSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIE 75
           +  R  SF  L   S+     F ++ V+EDLVRKRAEHN+ EI TLEEI+LHQ+ IEKIE
Sbjct: 633 IATRGKSFTNLNAFSIPIFHAFQSSGVTEDLVRKRAEHNNLEISTLEEISLHQQDIEKIE 692

Query: 76  ALDKWCKHLRILLLHSNIISKL 97
            LD+WC+ L+IL L SN+I K+
Sbjct: 693 NLDRWCRDLKILYLQSNLIPKI 714




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|115774597|ref|XP_791802.2| PREDICTED: protein TILB homolog [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|313245299|emb|CBY40071.1| unnamed protein product [Oikopleura dioica] Back     alignment and taxonomy information
>gi|313218365|emb|CBY41595.1| unnamed protein product [Oikopleura dioica] Back     alignment and taxonomy information
>gi|313225879|emb|CBY21022.1| unnamed protein product [Oikopleura dioica] Back     alignment and taxonomy information
>gi|350419152|ref|XP_003492089.1| PREDICTED: leucine-rich repeat-containing protein 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340708838|ref|XP_003393026.1| PREDICTED: leucine-rich repeat-containing protein 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|221128471|ref|XP_002157387.1| PREDICTED: protein TILB homolog [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|196002221|ref|XP_002110978.1| hypothetical protein TRIADDRAFT_22994 [Trichoplax adhaerens] gi|190586929|gb|EDV26982.1| hypothetical protein TRIADDRAFT_22994, partial [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|226479220|emb|CAX73105.1| Protein phosphatase 1 regulatory subunit 7 [Schistosoma japonicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
UNIPROTKB|F1NUJ0 476 LRRC6 "Uncharacterized protein 0.57 0.119 0.631 1.3e-14
FB|FBgn0014395 395 tilB "touch insensitive larva 0.56 0.141 0.589 1.3e-13
RGD|1559937 306 Lrrc6 "leucine rich repeat con 0.56 0.183 0.517 4.3e-13
ZFIN|ZDB-GENE-040827-2 440 lrrc6 "leucine rich repeat con 0.56 0.127 0.553 4.7e-13
UNIPROTKB|Q86X45 466 LRRC6 "Protein TILB homolog" [ 0.56 0.120 0.535 6.8e-13
UNIPROTKB|Q1RMR5 472 LRRC6 "Protein TILB homolog" [ 0.56 0.118 0.535 7e-13
MGI|MGI:1859553 473 Lrrc6 "leucine rich repeat con 0.56 0.118 0.535 7e-13
UNIPROTKB|F1RRU0 472 LRRC6 "Uncharacterized protein 0.56 0.118 0.535 1.5e-12
UNIPROTKB|Q9NJE9 383 lrrc6 "Protein TILB homolog" [ 0.56 0.146 0.464 8e-09
UNIPROTKB|F1NUJ0 LRRC6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 194 (73.4 bits), Expect = 1.3e-14, P = 1.3e-14
 Identities = 36/57 (63%), Positives = 49/57 (85%)

Query:    41 TVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL 97
             +V+EDLVR+RAEHN+ EI +LEEI+LHQ+ IEK+E LDKWC+ L+IL L +N+I K+
Sbjct:     3 SVTEDLVRRRAEHNNCEIFSLEEISLHQQEIEKLEYLDKWCRDLKILYLQNNLIPKI 59




GO:0000239 "pachytene" evidence=IEA
GO:0000240 "diplotene" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008584 "male gonad development" evidence=IEA
FB|FBgn0014395 tilB "touch insensitive larva B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1559937 Lrrc6 "leucine rich repeat containing 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040827-2 lrrc6 "leucine rich repeat containing 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q86X45 LRRC6 "Protein TILB homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1RMR5 LRRC6 "Protein TILB homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1859553 Lrrc6 "leucine rich repeat containing 6 (testis)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRU0 LRRC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NJE9 lrrc6 "Protein TILB homolog" [Trypanosoma brucei brucei (taxid:5702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28FY0TILB_XENTRNo assigned EC number0.60710.560.1191yesN/A
O88978TILB_MOUSENo assigned EC number0.53570.560.1183yesN/A
Q1RMR5TILB_BOVINNo assigned EC number0.53570.560.1186yesN/A
Q9VR52TILB_DROMENo assigned EC number0.58920.560.1417yesN/A
Q86X45TILB_HUMANNo assigned EC number0.53570.560.1201yesN/A
B3DH20TILB_DANRENo assigned EC number0.55350.560.1272yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
PF14580 175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.54
KOG0531|consensus 414 96.64
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.17
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 96.1
KOG1644|consensus 233 95.18
KOG2123|consensus 388 94.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 93.07
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 92.93
KOG0531|consensus 414 90.7
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.1
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 88.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 83.97
KOG4194|consensus 873 82.67
smart0037026 LRR Leucine-rich repeats, outliers. 81.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.51
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 80.17
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
Probab=98.87  E-value=3.4e-10  Score=83.39  Aligned_cols=59  Identities=27%  Similarity=0.384  Sum_probs=12.8

Q ss_pred             hhHHhHHHHHhhcccccccccchhhhhcchhhhhhHhhHHHhcchhhhhhhccCCcccccC
Q psy10771         39 WTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGK   99 (100)
Q Consensus        39 MvrIT~eLIRKraEHNe~~L~tLEElsLHQq~IEkIE~L~~~CRnLkILYLQNNlIskIEN   99 (100)
                      |||+|.|+|++.+.+++..  .+.|++|+.-.|.+||.++..+.+|+.|+|++|.|++||+
T Consensus         1 ~~~lt~~~i~~~~~~~n~~--~~~~L~L~~n~I~~Ie~L~~~l~~L~~L~Ls~N~I~~l~~   59 (175)
T PF14580_consen    1 MVRLTANMIEQIAQYNNPV--KLRELNLRGNQISTIENLGATLDKLEVLDLSNNQITKLEG   59 (175)
T ss_dssp             -------------------------------------S--TT-TT--EEE-TTS--S--TT
T ss_pred             Ccccccccccccccccccc--ccccccccccccccccchhhhhcCCCEEECCCCCCccccC
Confidence            8999999999999999987  7899999999999999999778999999999999999986



>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1ds9_A 198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1a9n_A 176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score = 49.7 bits (119), Expect = 6e-09
 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 41 TVSEDLVRKRAEHNDKEIGTLEEIALHQEH--IEKIEALDKWCKHLRILLLHSNIISKL 97
          T  +D +R   E         E++ LH     IEK++A     K  + L L +N I K+
Sbjct: 5  TTIKDAIRIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKI 63


>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
1a9n_A 176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.91
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 92.92
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.78
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 92.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 92.3
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 91.92
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 91.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 91.68
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 91.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 91.5
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 91.24
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 90.8
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 90.7
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 90.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 90.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 90.11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 89.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 89.52
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 89.41
3sb4_A 329 Hypothetical leucine rich repeat protein; LRR, rig 89.15
3e6j_A229 Variable lymphocyte receptor diversity region; var 89.13
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 88.67
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 88.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 88.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 88.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 88.0
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 87.99
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 87.96
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 87.46
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 87.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 87.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 86.88
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 86.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 86.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 86.24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 86.13
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 85.94
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 85.91
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 85.88
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 85.73
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 85.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 85.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 85.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 84.92
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 84.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 84.71
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 84.39
3e6j_A229 Variable lymphocyte receptor diversity region; var 84.22
3m19_A 251 Variable lymphocyte receptor A diversity region; a 84.22
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 84.11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 83.81
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 83.72
1o6v_A 466 Internalin A; bacterial infection, extracellular r 83.57
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 83.5
1o6v_A 466 Internalin A; bacterial infection, extracellular r 83.27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 83.14
3m19_A251 Variable lymphocyte receptor A diversity region; a 83.07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 82.92
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 82.9
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 82.75
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 82.75
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 82.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 82.19
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 82.13
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 81.85
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 81.84
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 81.74
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 81.53
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 81.2
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 81.17
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 81.04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 80.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 80.57
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 80.5
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 80.48
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 80.35
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 80.22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 80.14
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
Probab=97.91  E-value=7.6e-07  Score=58.86  Aligned_cols=57  Identities=21%  Similarity=0.236  Sum_probs=47.2

Q ss_pred             hhHHhHHHHHhhcccccccccchhhhhcchhhhhhHhhHHHhcchhhhhhhccCCcccc
Q psy10771         39 WTTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKL   97 (100)
Q Consensus        39 MvrIT~eLIRKraEHNe~~L~tLEElsLHQq~IEkIE~L~~~CRnLkILYLQNNlIskI   97 (100)
                      |+++|.++|++.+..-  -..+|++++|+.-.|..|+.+...+++|+.|+|++|.|+.+
T Consensus         1 m~~lt~~~i~~~~~~~--~~~~L~~L~l~~n~l~~i~~~~~~~~~L~~L~Ls~N~l~~~   57 (176)
T 1a9n_A            1 MVKLTAELIEQAAQYT--NAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKL   57 (176)
T ss_dssp             -CCCCHHHHHTSCEEE--CTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEE
T ss_pred             CccccHHHHHHHHhcC--CcCCceEEEeeCCCCchhHHhhhcCCCCCEEECCCCCCCcc
Confidence            8999999999876543  36789999999999998888887777999999999988765



>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1a9na_ 162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.18
d1m9la_ 198 Outer arm dynein light chain 1 {Green algae (Chlam 96.61
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 95.97
d2omxa2 199 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 95.21
d1h6ta2 210 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.14
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.07
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 95.06
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 95.0
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 94.97
d1h6ua2 227 Internalin H {Listeria monocytogenes [TaxId: 1639] 94.39
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 94.34
d1h6ta2 210 Internalin B {Listeria monocytogenes [TaxId: 1639] 93.76
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 93.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 92.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 91.69
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 90.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 90.14
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 90.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 86.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 83.7
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 83.22
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 83.03
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 82.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 82.54
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.18  E-value=5.5e-08  Score=64.69  Aligned_cols=58  Identities=21%  Similarity=0.240  Sum_probs=50.1

Q ss_pred             hHHhHHHHHhhcccccccccchhhhhcchhhhhhHhhHHHhcchhhhhhhccCCcccccC
Q psy10771         40 TTVSEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLGK   99 (100)
Q Consensus        40 vrIT~eLIRKraEHNe~~L~tLEElsLHQq~IEkIE~L~~~CRnLkILYLQNNlIskIEN   99 (100)
                      ||+|.++|.+.....+  ..++.|++|+.-.|..|+.+...|++|++|+|++|.|+.+++
T Consensus         1 ~rLt~~~i~~~~~~~n--~~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~   58 (162)
T d1a9na_           1 VKLTAELIEQAAQYTN--AVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDG   58 (162)
T ss_dssp             CCCCHHHHHTSCEEEC--TTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECC
T ss_pred             CCCCHHHHhhhHhccC--cCcCcEEECCCCCCCccCccccccccCCEEECCCCCCCccCC
Confidence            6899999998876653  337899999999999999888789999999999999998864



>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure