Diaphorina citri psyllid: psy10774


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MNNLLNPLWSDSEEDGPQEEGIRHQVFRARVNFNTANDFIFVERFRVSRDVVEQILTTVSPFLEHPTNRRHALTSRQQVLLTLHWLGNGAQYHITADAHGVSKSTVQRTVHKPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAIALGHPIGASGTRVLVTLLYALKRLNKSKGCAVDEL
cccccccccccccccccccccccccEEEEEECccccccEEEEcccccccccHHHHHHccccccccccccccccccHHHHHHHHcccHHHHHccccccEEEEEEECcccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccHHHHHHHHHHHHHHccccEEEccccc
****LNP**************IRHQVFRARVNFNTANDFIFVERFRVSRDVVEQILTTVSPFLEHPTNRRHALTSRQQVLLTLHWLGNGAQYHITADAHGVSKSTVQRTVHKPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAIALGHPIGASGTRVLVTLLYALKRLNKSKGCAVD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNLLNPLWSDSEEDGPQEEGIRHQVFRARVNFNTANDFIFVERFRVSRDVVEQILTTVSPFLEHPTNRRHALTSRQQVLLTLHWLGNGAQYHITADAHGVSKSTVQRTVHKPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAIALGHPIGASGTRVLVTLLYALKRLNKSKGCAVDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-ketoacyl-CoA thiolase Catalyzes the final step of fatty acid oxidation in which acetyl-CoA is released and the CoA ester of a fatty acid two carbons shorter is formed.confidentB6EGU1
3-ketoacyl-CoA thiolase Catalyzes the final step of fatty acid oxidation in which acetyl-CoA is released and the CoA ester of a fatty acid two carbons shorter is formed.confidentQ66FR9
3-ketoacyl-CoA thiolase Catalyzes the final step of fatty acid oxidation in which acetyl-CoA is released and the CoA ester of a fatty acid two carbons shorter is formed.confidentA1JIG3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0006635 [BP]fatty acid beta-oxidationprobableGO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0048545 [BP]response to steroid hormone stimulusprobableGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0003985 [MF]acetyl-CoA C-acetyltransferase activityprobableGO:0003674, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0003988, GO:0016453, GO:0016408
GO:0000038 [BP]very long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0008206 [BP]bile acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0043436, GO:1901360, GO:0044281
GO:0006084 [BP]acetyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WL4, chain A
Confidence level:very confident
Coverage over the Query: 49-205
View the alignment between query and template
View the model in PyMOL