Psyllid ID: psy10774
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| 260782216 | 394 | hypothetical protein BRAFLDRAFT_109688 [ | 0.439 | 0.230 | 0.703 | 5e-31 | |
| 383853413 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.444 | 0.233 | 0.706 | 8e-31 | |
| 340371107 | 397 | PREDICTED: acetyl-CoA acetyltransferase, | 0.439 | 0.229 | 0.703 | 8e-31 | |
| 225719620 | 396 | Acetyl-CoA acetyltransferase [Caligus cl | 0.434 | 0.227 | 0.722 | 1e-30 | |
| 380026455 | 396 | PREDICTED: acetyl-CoA acetyltransferase, | 0.444 | 0.232 | 0.695 | 1e-30 | |
| 340710557 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.444 | 0.233 | 0.695 | 2e-30 | |
| 332024791 | 441 | Acetyl-CoA acetyltransferase, cytosolic | 0.444 | 0.208 | 0.684 | 4e-30 | |
| 156548948 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.444 | 0.233 | 0.706 | 4e-30 | |
| 156376494 | 399 | predicted protein [Nematostella vectensi | 0.439 | 0.228 | 0.703 | 7e-30 | |
| 350427397 | 394 | PREDICTED: acetyl-CoA acetyltransferase, | 0.444 | 0.233 | 0.684 | 1e-29 |
| >gi|260782216|ref|XP_002586186.1| hypothetical protein BRAFLDRAFT_109688 [Branchiostoma floridae] gi|229271281|gb|EEN42197.1| hypothetical protein BRAFLDRAFT_109688 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Score = 139 bits (351), Expect = 5e-31, Method: Compositional matrix adjust.
Identities = 64/91 (70%), Positives = 79/91 (86%)
Query: 113 PTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAI 172
P++MGTGPIPA+ L KA W+K+EVDLFELNEAFAAQS+A +++LGLD +KVNVSGGAI
Sbjct: 287 PSIMGTGPIPAIRKALEKAKWTKDEVDLFELNEAFAAQSLAVVKDLGLDSSKVNVSGGAI 346
Query: 173 ALGHPIGASGTRVLVTLLYALKRLNKSKGCA 203
A+GHPIGASG+R+LVTLLYAL+R +G A
Sbjct: 347 AIGHPIGASGSRILVTLLYALQRTGGHRGVA 377
|
Source: Branchiostoma floridae Species: Branchiostoma floridae Genus: Branchiostoma Family: Branchiostomidae Order: Class: Phylum: Chordata Superkingdom: Eukaryota |
| >gi|383853413|ref|XP_003702217.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340371107|ref|XP_003384087.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
| >gi|225719620|gb|ACO15656.1| Acetyl-CoA acetyltransferase [Caligus clemensi] | Back alignment and taxonomy information |
|---|
| >gi|380026455|ref|XP_003696967.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340710557|ref|XP_003393854.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Bombus terrestris] gi|385258402|gb|AFI55097.1| acetyl-CoA acetyltransferase [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332024791|gb|EGI64979.1| Acetyl-CoA acetyltransferase, cytosolic [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|156548948|ref|XP_001607032.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|156376494|ref|XP_001630395.1| predicted protein [Nematostella vectensis] gi|156217415|gb|EDO38332.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|350427397|ref|XP_003494745.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| FB|FBgn0035203 | 392 | CG9149 [Drosophila melanogaste | 0.444 | 0.234 | 0.684 | 2.4e-28 | |
| UNIPROTKB|F1SB62 | 406 | ACAT2 "Uncharacterized protein | 0.516 | 0.263 | 0.590 | 3.1e-28 | |
| UNIPROTKB|B7Z233 | 426 | ACAT2 "cDNA FLJ53975, highly s | 0.444 | 0.215 | 0.619 | 3.9e-28 | |
| UNIPROTKB|Q9BWD1 | 397 | ACAT2 "Acetyl-CoA acetyltransf | 0.444 | 0.231 | 0.619 | 3.9e-28 | |
| UNIPROTKB|F1Q466 | 406 | ACAT2 "Uncharacterized protein | 0.444 | 0.226 | 0.619 | 8.2e-28 | |
| MGI|MGI:87871 | 397 | Acat2 "acetyl-Coenzyme A acety | 0.444 | 0.231 | 0.630 | 1e-27 | |
| RGD|1359366 | 397 | Acat2 "acetyl-CoA acetyltransf | 0.444 | 0.231 | 0.619 | 2.8e-27 | |
| UNIPROTKB|Q17QI3 | 397 | ACAT2 "Uncharacterized protein | 0.444 | 0.231 | 0.619 | 5.7e-27 | |
| RGD|1562948 | 397 | RGD1562948 "similar to Ab2-076 | 0.444 | 0.231 | 0.597 | 7.3e-27 | |
| ZFIN|ZDB-GENE-990714-22 | 395 | acat2 "acetyl-CoA acetyltransf | 0.439 | 0.230 | 0.637 | 1.2e-26 |
| FB|FBgn0035203 CG9149 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
Identities = 63/92 (68%), Positives = 74/92 (80%)
Query: 112 KPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGA 171
+P +MG GP+ AV A+L K W +EEVDL+ELNEAFAAQS+A L++L LD KVNV+GGA
Sbjct: 283 EPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVLQDLQLDAQKVNVNGGA 342
Query: 172 IALGHPIGASGTRVLVTLLYALKRLNKSKGCA 203
IALGHPIGASG RVLVTLLYAL+R KG A
Sbjct: 343 IALGHPIGASGARVLVTLLYALERTGGRKGIA 374
|
|
| UNIPROTKB|F1SB62 ACAT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z233 ACAT2 "cDNA FLJ53975, highly similar to Acetyl-CoA acetyltransferase, cytosolic (EC 2.3.1.9)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BWD1 ACAT2 "Acetyl-CoA acetyltransferase, cytosolic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q466 ACAT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87871 Acat2 "acetyl-Coenzyme A acetyltransferase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359366 Acat2 "acetyl-CoA acetyltransferase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QI3 ACAT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1562948 RGD1562948 "similar to Ab2-076" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990714-22 acat2 "acetyl-CoA acetyltransferase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 1e-49 | |
| PRK05790 | 393 | PRK05790, PRK05790, putative acyltransferase; Prov | 2e-48 | |
| pfam02803 | 123 | pfam02803, Thiolase_C, Thiolase, C-terminal domain | 3e-44 | |
| TIGR01930 | 386 | TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans | 5e-43 | |
| PRK05656 | 393 | PRK05656, PRK05656, acetyl-CoA acetyltransferase; | 2e-33 | |
| PLN02287 | 452 | PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | 3e-33 | |
| PRK09050 | 401 | PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; | 8e-33 | |
| PRK09051 | 394 | PRK09051, PRK09051, beta-ketothiolase; Provisional | 4e-32 | |
| PRK07661 | 391 | PRK07661, PRK07661, acetyl-CoA acetyltransferase; | 6e-32 | |
| PRK09052 | 399 | PRK09052, PRK09052, acetyl-CoA acetyltransferase; | 9e-32 | |
| PRK08947 | 387 | PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | 1e-31 | |
| TIGR02430 | 400 | TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | 1e-31 | |
| PRK06633 | 392 | PRK06633, PRK06633, acetyl-CoA acetyltransferase; | 2e-31 | |
| PRK07851 | 406 | PRK07851, PRK07851, acetyl-CoA acetyltransferase; | 2e-31 | |
| PRK08170 | 426 | PRK08170, PRK08170, acetyl-CoA acetyltransferase; | 1e-30 | |
| PRK08242 | 402 | PRK08242, PRK08242, acetyl-CoA acetyltransferase; | 2e-30 | |
| PRK06205 | 404 | PRK06205, PRK06205, acetyl-CoA acetyltransferase; | 2e-30 | |
| PRK13359 | 400 | PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; | 7e-30 | |
| PRK08235 | 393 | PRK08235, PRK08235, acetyl-CoA acetyltransferase; | 2e-29 | |
| PRK06025 | 417 | PRK06025, PRK06025, acetyl-CoA acetyltransferase; | 2e-28 | |
| PRK06504 | 390 | PRK06504, PRK06504, acetyl-CoA acetyltransferase; | 2e-28 | |
| PRK06445 | 394 | PRK06445, PRK06445, acetyl-CoA acetyltransferase; | 8e-28 | |
| PRK07801 | 382 | PRK07801, PRK07801, acetyl-CoA acetyltransferase; | 1e-27 | |
| PLN02644 | 394 | PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | 9e-27 | |
| COG0183 | 392 | COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid | 1e-26 | |
| TIGR02445 | 385 | TIGR02445, fadA, fatty oxidation complex, beta sub | 3e-26 | |
| PRK08131 | 401 | PRK08131, PRK08131, acetyl-CoA acetyltransferase; | 5e-26 | |
| PRK06954 | 397 | PRK06954, PRK06954, acetyl-CoA acetyltransferase; | 6e-26 | |
| PRK07850 | 387 | PRK07850, PRK07850, acetyl-CoA acetyltransferase; | 2e-25 | |
| PRK06690 | 361 | PRK06690, PRK06690, acetyl-CoA acetyltransferase; | 1e-24 | |
| PRK07108 | 392 | PRK07108, PRK07108, acetyl-CoA acetyltransferase; | 2e-21 | |
| cd00826 | 393 | cd00826, nondecarbox_cond_enzymes, nondecarboxylat | 7e-20 | |
| PRK06366 | 388 | PRK06366, PRK06366, acetyl-CoA acetyltransferase; | 2e-18 | |
| PRK08963 | 428 | PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | 5e-15 | |
| cd00327 | 254 | cd00327, cond_enzymes, Condensing enzymes; Family | 2e-13 | |
| PRK09268 | 427 | PRK09268, PRK09268, acetyl-CoA acetyltransferase; | 5e-13 | |
| TIGR02446 | 430 | TIGR02446, FadI, fatty oxidation complex, beta sub | 9e-12 | |
| cd00829 | 375 | cd00829, SCP-x_thiolase, Thiolase domain associate | 5e-07 | |
| PRK06064 | 389 | PRK06064, PRK06064, acetyl-CoA acetyltransferase; | 2e-05 | |
| PRK06289 | 403 | PRK06289, PRK06289, acetyl-CoA acetyltransferase; | 3e-05 | |
| PRK06365 | 430 | PRK06365, PRK06365, acetyl-CoA acetyltransferase; | 7e-05 | |
| PRK08256 | 391 | PRK08256, PRK08256, lipid-transfer protein; Provis | 2e-04 | |
| pfam13613 | 95 | pfam13613, DDE_4_2, DDE superfamily endonuclease | 4e-04 | |
| COG0304 | 412 | COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy | 0.002 | |
| PTZ00455 | 438 | PTZ00455, PTZ00455, 3-ketoacyl-CoA thiolase; Provi | 0.004 |
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
Score = 165 bits (420), Expect = 1e-49
Identities = 55/91 (60%), Positives = 72/91 (79%)
Query: 113 PTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAI 172
P +MG GP+PA+ L +AG + +++DL E+NEAFAAQ++ACL+ELGLD KVNV+GGAI
Sbjct: 280 PAIMGIGPVPAIPKALKRAGLTLDDIDLIEINEAFAAQALACLKELGLDPEKVNVNGGAI 339
Query: 173 ALGHPIGASGTRVLVTLLYALKRLNKSKGCA 203
ALGHP+GASG R++VTLL+ LKR G A
Sbjct: 340 ALGHPLGASGARIVVTLLHELKRRGGRYGLA 370
|
They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways. Length = 386 |
| >gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145779 pfam02803, Thiolase_C, Thiolase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|168156 PRK05656, PRK05656, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215161 PLN02287, PLN02287, 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181625 PRK09051, PRK09051, beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181072 PRK07661, PRK07661, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181626 PRK09052, PRK09052, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181592 PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131483 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase | Back alignment and domain information |
|---|
| >gnl|CDD|168632 PRK06633, PRK06633, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181146 PRK07851, PRK07851, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181265 PRK08170, PRK08170, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236197 PRK08242, PRK08242, acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183998 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181311 PRK08235, PRK08235, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235675 PRK06025, PRK06025, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180595 PRK06504, PRK06504, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180563 PRK06445, PRK06445, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181123 PRK07801, PRK07801, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131498 TIGR02445, fadA, fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >gnl|CDD|181242 PRK08131, PRK08131, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180775 PRK06954, PRK06954, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181145 PRK07850, PRK07850, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180843 PRK07108, PRK07108, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >gnl|CDD|236440 PRK09268, PRK09268, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >gnl|CDD|238425 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >gnl|CDD|235688 PRK06064, PRK06064, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235771 PRK06289, PRK06289, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235785 PRK06365, PRK06365, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181327 PRK08256, PRK08256, lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222263 pfam13613, DDE_4_2, DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240424 PTZ00455, PTZ00455, 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| PF02803 | 123 | Thiolase_C: Thiolase, C-terminal domain; InterPro: | 99.96 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.96 | |
| KOG1389|consensus | 435 | 99.96 | ||
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 99.95 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK08131 | 401 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 99.95 | |
| PRK07108 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| KOG1390|consensus | 396 | 99.94 | ||
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 99.94 | |
| PRK09268 | 427 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 99.94 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.94 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 99.94 | |
| KOG1391|consensus | 396 | 99.94 | ||
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 99.94 | |
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 99.94 | |
| PRK08963 | 428 | fadI 3-ketoacyl-CoA thiolase; Reviewed | 99.94 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 99.94 | |
| PRK08947 | 387 | fadA 3-ketoacyl-CoA thiolase; Reviewed | 99.94 | |
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| TIGR02445 | 385 | fadA fatty oxidation complex, beta subunit FadA. T | 99.93 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 99.93 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 99.93 | |
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 99.93 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 99.92 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 99.92 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 99.92 | |
| PRK06289 | 403 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| PRK06158 | 384 | thiolase; Provisional | 99.91 | |
| PTZ00455 | 438 | 3-ketoacyl-CoA thiolase; Provisional | 99.91 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.91 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 99.91 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 99.9 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.9 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 99.9 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 99.9 | |
| KOG1392|consensus | 465 | 99.9 | ||
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 99.9 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 99.9 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 99.89 | |
| PRK07516 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.89 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.89 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 99.89 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 99.89 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.87 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 99.83 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 99.77 | |
| KOG1406|consensus | 408 | 99.77 | ||
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 98.91 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 98.82 | |
| PRK06333 | 424 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.55 | |
| PRK07314 | 411 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 98.52 | |
| PRK07103 | 410 | polyketide beta-ketoacyl:acyl carrier protein synt | 98.3 | |
| PLN02836 | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase | 98.21 | |
| PTZ00050 | 421 | 3-oxoacyl-acyl carrier protein synthase; Provision | 98.14 | |
| cd00834 | 406 | KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) | 97.97 | |
| PRK14691 | 342 | 3-oxoacyl-(acyl carrier protein) synthase II; Prov | 97.96 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 97.79 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 97.78 | |
| PRK06501 | 425 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.76 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 97.76 | |
| PRK07910 | 418 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.7 | |
| PRK05952 | 381 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.63 | |
| PRK08722 | 414 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 97.46 | |
| cd00833 | 421 | PKS polyketide synthases (PKSs) polymerize simple | 97.28 | |
| cd00828 | 407 | elong_cond_enzymes "elongating" condensing enzymes | 97.21 | |
| PRK06147 | 348 | 3-oxoacyl-(acyl carrier protein) synthase; Validat | 96.84 | |
| PLN02787 | 540 | 3-oxoacyl-[acyl-carrier-protein] synthase II | 96.75 | |
| cd00832 | 399 | CLF Chain-length factor (CLF) is a factor required | 96.68 | |
| PRK09116 | 405 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 96.65 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 96.07 | |
| PF08541 | 90 | ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC | 96.06 | |
| PRK06519 | 398 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 96.02 | |
| COG0304 | 412 | FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li | 95.94 | |
| PF02801 | 119 | Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina | 95.85 | |
| KOG1394|consensus | 440 | 95.82 | ||
| PRK08439 | 406 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 94.88 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 94.88 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 94.56 | |
| PLN03168 | 389 | chalcone synthase; Provisional | 94.54 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 94.28 | |
| PLN02377 | 502 | 3-ketoacyl-CoA synthase | 94.19 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 94.17 | |
| PLN02326 | 379 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 93.82 | |
| COG3425 | 377 | PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi | 93.74 | |
| PRK09258 | 338 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 93.61 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 93.6 | |
| PRK04262 | 347 | hypothetical protein; Provisional | 93.59 | |
| PLN03173 | 391 | chalcone synthase; Provisional | 93.42 | |
| PLN02932 | 478 | 3-ketoacyl-CoA synthase | 93.38 | |
| PRK09352 | 319 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 93.32 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 93.24 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 93.16 | |
| PF00108 | 264 | Thiolase_N: Thiolase, N-terminal domain; InterPro: | 93.11 | |
| PLN00415 | 466 | 3-ketoacyl-CoA synthase | 92.94 | |
| PRK06840 | 339 | hypothetical protein; Validated | 92.83 | |
| PLN03172 | 393 | chalcone synthase family protein; Provisional | 92.8 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 92.41 | |
| PF08392 | 290 | FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- | 92.4 | |
| PRK06158 | 384 | thiolase; Provisional | 92.07 | |
| PLN02192 | 511 | 3-ketoacyl-CoA synthase | 91.89 | |
| PF00195 | 226 | Chal_sti_synt_N: Chalcone and stilbene synthases, | 91.83 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 91.61 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 91.52 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 91.46 | |
| PLN03171 | 399 | chalcone synthase-like protein; Provisional | 91.43 | |
| PLN03169 | 391 | chalcone synthase family protein; Provisional | 91.4 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 91.12 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 91.12 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 91.03 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 90.9 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 90.89 | |
| COG0332 | 323 | FabH 3-oxoacyl-[acyl-carrier-protein] | 90.84 | |
| TIGR02845 | 327 | spore_V_AD stage V sporulation protein AD. Bacillu | 90.8 | |
| PLN03170 | 401 | chalcone synthase; Provisional | 90.8 | |
| PRK09258 | 338 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 90.67 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 90.64 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 90.48 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 90.39 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 90.39 | |
| COG3424 | 356 | BcsA Predicted naringenin-chalcone synthase [Secon | 90.3 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 90.28 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 90.22 | |
| COG3424 | 356 | BcsA Predicted naringenin-chalcone synthase [Secon | 90.11 | |
| PRK08304 | 337 | stage V sporulation protein AD; Validated | 90.0 | |
| PRK12880 | 353 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 90.0 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 89.73 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 89.62 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 89.34 | |
| cd00831 | 361 | CHS_like Chalcone and stilbene synthases; plant-sp | 89.24 | |
| PRK07967 | 406 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 88.89 | |
| PRK08304 | 337 | stage V sporulation protein AD; Validated | 88.86 | |
| PRK04262 | 347 | hypothetical protein; Provisional | 88.81 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 88.79 | |
| PRK12404 | 334 | stage V sporulation protein AD; Provisional | 88.79 | |
| PLN02326 | 379 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 88.47 | |
| cd00827 | 324 | init_cond_enzymes "initiating" condensing enzymes | 88.44 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 88.42 | |
| PRK09352 | 319 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 88.31 | |
| cd00827 | 324 | init_cond_enzymes "initiating" condensing enzymes | 88.28 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 88.07 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 87.87 | |
| PLN02854 | 521 | 3-ketoacyl-CoA synthase | 87.52 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 87.45 | |
| PRK12880 | 353 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 87.43 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 87.38 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 87.35 | |
| TIGR02845 | 327 | spore_V_AD stage V sporulation protein AD. Bacillu | 87.35 | |
| PLN03169 | 391 | chalcone synthase family protein; Provisional | 87.1 | |
| COG0332 | 323 | FabH 3-oxoacyl-[acyl-carrier-protein] | 87.05 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 86.84 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 86.83 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 86.6 | |
| PLN03172 | 393 | chalcone synthase family protein; Provisional | 86.44 | |
| PRK06840 | 339 | hypothetical protein; Validated | 86.4 | |
| cd00831 | 361 | CHS_like Chalcone and stilbene synthases; plant-sp | 86.28 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 86.17 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 85.45 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 85.39 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 84.85 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 84.62 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 84.0 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 82.89 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 82.88 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 82.81 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 82.18 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 81.39 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 80.74 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 80.61 |
| >PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
Probab=99.96 E-value=6.4e-30 Score=193.60 Aligned_cols=101 Identities=47% Similarity=0.728 Sum_probs=88.4
Q ss_pred cccccccCCCccCCCchHHHHHHHHHcCCCCCCcceeeecccchHHHHHHHHHcCCCCCcccccCCcccCCCCCcchHHH
Q psy10774 105 TVQRTVHKPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAIALGHPIGASGTR 184 (207)
Q Consensus 105 t~~~~~~~p~~~~~~~~~a~~~al~~ag~~~~did~~ei~d~fa~~~l~~~e~lGl~~~~vN~~GG~la~Ghp~gasG~~ 184 (207)
++...+.+|..++.+|..|++++|+++|++++|||++|+||+|+++++.++|+||+++.|||++||++++|||+|+||++
T Consensus 9 ~~~~~~~~P~~~~~~p~~A~~~al~~ag~~~~did~~Ei~EaFA~~~l~~~~~lg~~~~~vN~~GG~la~GHP~gasG~r 88 (123)
T PF02803_consen 9 GYASAGVDPEDMGLGPVPAARKALERAGLTPDDIDVIEINEAFAAQVLAFLEALGLDPEKVNPNGGALALGHPLGASGAR 88 (123)
T ss_dssp EEEEEE--GGGGGGTHHHHHHHHHHHHT--GGGESEEEE--SBHHHHHHHHHHHTTGGGGBSTT--HHHH-BHTTTHHHH
T ss_pred EEEEEecCHHHhCchHHHHHHHHHHHhCCCccccchhhccchhhhHHHHhhccccccccccCcccccccccccccccccc
Confidence 45567889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhcCCCeEEEee
Q psy10774 185 VLVTLLYALKRLNKSKGCAVD 205 (207)
Q Consensus 185 ~~~e~~~qL~~~~g~~gl~~~ 205 (207)
+++++++||+++++++|++++
T Consensus 89 ~~~~l~~~L~~~~~~~gla~~ 109 (123)
T PF02803_consen 89 LVVELAHQLRRRGGRYGLAAI 109 (123)
T ss_dssp HHHHHHHHHHHHTTSEEEEEE
T ss_pred hhhhhHHHHHHhchhhhhHHh
Confidence 999999999999999999986
|
3.1.9 from EC) and 3-ketoacyl-CoA thiolase (2.3.1.16 from EC). 3-ketoacyl-CoA thiolase (also called thiolase I) has a broad chain-length specificity for its substrates and is involved in degradative pathways such as fatty acid beta-oxidation. Acetoacetyl-CoA thiolase (also called thiolase II) is specific for the thiolysis of acetoacetyl-CoA and involved in biosynthetic pathways such as poly beta-hydroxybutyrate synthesis or steroid biogenesis. In eukaryotes, there are two forms of 3-ketoacyl-CoA thiolase: one located in the mitochondrion and the other in peroxisomes. There are two conserved cysteine residues important for thiolase activity. The first located in the N-terminal section of the enzymes is involved in the formation of an acyl-enzyme intermediate; the second located at the C-terminal extremity is the active site base involved in deprotonation in the condensation reaction. Mammalian nonspecific lipid-transfer protein (nsL-TP) (also known as sterol carrier protein 2) is a protein which seems to exist in two different forms: a 14 Kd protein (SCP-2) and a larger 58 Kd protein (SCP-x). The former is found in the cytoplasm or the mitochondria and is involved in lipid transport; the latter is found in peroxisomes. The C-terminal part of SCP-x is identical to SCP-2 while the N-terminal portion is evolutionary related to thiolases [].; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups, 0008152 metabolic process; PDB: 2WUA_B 4E1L_B 3SVK_A 1WDK_D 1WDM_D 2D3T_D 1WDL_C 2IB8_B 2IBU_A 2IB9_C .... |
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1389|consensus | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08131 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07108 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1390|consensus | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PRK09268 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >KOG1391|consensus | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02445 fadA fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06289 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00455 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1392|consensus | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >PRK07516 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1406|consensus | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated | Back alignment and domain information |
|---|
| >PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
| >cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 | Back alignment and domain information |
|---|
| >PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >KOG1394|consensus | Back alignment and domain information |
|---|
| >PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >PLN03168 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PLN02377 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III | Back alignment and domain information |
|---|
| >COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK04262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03173 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02932 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >PLN00415 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK06840 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN03172 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PLN02192 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PLN03171 chalcone synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03169 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >TIGR02845 spore_V_AD stage V sporulation protein AD | Back alignment and domain information |
|---|
| >PLN03170 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK08304 stage V sporulation protein AD; Validated | Back alignment and domain information |
|---|
| >PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs | Back alignment and domain information |
|---|
| >PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK08304 stage V sporulation protein AD; Validated | Back alignment and domain information |
|---|
| >PRK04262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK12404 stage V sporulation protein AD; Provisional | Back alignment and domain information |
|---|
| >PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III | Back alignment and domain information |
|---|
| >cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PLN02854 3-ketoacyl-CoA synthase | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >TIGR02845 spore_V_AD stage V sporulation protein AD | Back alignment and domain information |
|---|
| >PLN03169 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PLN03172 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06840 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 207 | ||||
| 1wl4_A | 397 | Human Cytosolic Acetoacetyl-Coa Thiolase Complexed | 6e-30 | ||
| 4e1l_A | 395 | Crystal Structure Of Acetoacetyl-Coa Thiolase (Thla | 1e-25 | ||
| 4dd5_A | 396 | Biosynthetic Thiolase (Thla1) From Clostridium Diff | 8e-25 | ||
| 1m4s_A | 392 | Biosynthetic Thiolase, Cys89 Acetylated, Unliganded | 2e-24 | ||
| 1dlu_A | 389 | Unliganded Biosynthetic Thiolase From Zoogloea Rami | 2e-24 | ||
| 1qfl_A | 389 | Biosynthetic Thiolase From Zoogloea Ramigera In Com | 2e-24 | ||
| 1m1o_A | 392 | Crystal Structure Of Biosynthetic Thiolase, C89a Mu | 2e-24 | ||
| 2vu2_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Wit | 2e-24 | ||
| 1m1t_A | 392 | Biosynthetic Thiolase, Q64a Mutant Length = 392 | 3e-24 | ||
| 2wkv_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 7e-24 | ||
| 2wku_A | 392 | Biosynthetic Thiolase From Z. Ramigera. The N316h M | 1e-23 | ||
| 2wl5_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 1e-23 | ||
| 2wl5_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 2e-23 | ||
| 2wl4_B | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 2e-23 | ||
| 2wl4_D | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 3e-23 | ||
| 2wl4_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 3e-23 | ||
| 2wl4_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 3e-23 | ||
| 2wl6_A | 392 | Biosynthetic Thiolase From Z. Ramigera. The N316h-H | 8e-23 | ||
| 3ss6_A | 394 | Crystal Structure Of The Bacillus Anthracis Acetyl- | 1e-22 | ||
| 2wu9_A | 442 | Crystal Structure Of Peroxisomal Kat2 From Arabidop | 7e-22 | ||
| 2c7y_A | 404 | Plant Enzyme Length = 404 | 8e-22 | ||
| 2wua_A | 440 | Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolas | 8e-21 | ||
| 1ulq_A | 401 | Crystal Structure Of Tt0182 From Thermus Thermophil | 1e-20 | ||
| 3goa_A | 387 | Crystal Structure Of The Salmonella Typhimurium Fad | 2e-20 | ||
| 1afw_A | 393 | The 1.8 Angstrom Crystal Structure Of The Dimeric P | 6e-20 | ||
| 1pxt_A | 390 | The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoac | 7e-20 | ||
| 2iik_A | 418 | Crystal Structure Of Human Peroxisomal Acetyl-Coa A | 3e-19 | ||
| 2wkt_A | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 7e-19 | ||
| 2wkt_C | 392 | Biosynthetic Thiolase From Z. Ramigera. Complex Of | 7e-19 | ||
| 1wdk_C | 390 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 5e-18 | ||
| 3svk_A | 407 | Crystal Structure Of Acetyl-Coa Acetyltransferase F | 2e-17 | ||
| 2ibu_A | 395 | Crystallographic And Kinetic Studies Of Human Mitoc | 2e-13 | ||
| 2ib7_A | 395 | Crystallographic And Kinetic Studies Of Human Mitoc | 2e-13 | ||
| 2f2s_A | 406 | Human Mitochondrial Acetoacetyl-Coa Thiolase Length | 2e-13 |
| >pdb|1WL4|A Chain A, Human Cytosolic Acetoacetyl-Coa Thiolase Complexed With Coa Length = 397 | Back alignment and structure |
|
| >pdb|4E1L|A Chain A, Crystal Structure Of Acetoacetyl-Coa Thiolase (Thla2) From Clostridium Difficile Length = 395 | Back alignment and structure |
| >pdb|4DD5|A Chain A, Biosynthetic Thiolase (Thla1) From Clostridium Difficile Length = 396 | Back alignment and structure |
| >pdb|1M4S|A Chain A, Biosynthetic Thiolase, Cys89 Acetylated, Unliganded Form Length = 392 | Back alignment and structure |
| >pdb|1DLU|A Chain A, Unliganded Biosynthetic Thiolase From Zoogloea Ramigera Length = 389 | Back alignment and structure |
| >pdb|1QFL|A Chain A, Biosynthetic Thiolase From Zoogloea Ramigera In Complex With A Reaction Intermediate. Length = 389 | Back alignment and structure |
| >pdb|1M1O|A Chain A, Crystal Structure Of Biosynthetic Thiolase, C89a Mutant, Complexed With Acetoacetyl-Coa Length = 392 | Back alignment and structure |
| >pdb|2VU2|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex With S- Pantetheine-11-pivalate. Length = 392 | Back alignment and structure |
| >pdb|1M1T|A Chain A, Biosynthetic Thiolase, Q64a Mutant Length = 392 | Back alignment and structure |
| >pdb|2WKV|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316d Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WKU|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h Mutant. Length = 392 | Back alignment and structure |
| >pdb|2WL5|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WL5|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WL4|B Chain B, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL4|D Chain D, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL4|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL4|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|2WL6|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h-H348n Mutant. Length = 392 | Back alignment and structure |
| >pdb|3SS6|A Chain A, Crystal Structure Of The Bacillus Anthracis Acetyl-Coa Acetyltransferase Length = 394 | Back alignment and structure |
| >pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis Thaliana Length = 442 | Back alignment and structure |
| >pdb|2C7Y|A Chain A, Plant Enzyme Length = 404 | Back alignment and structure |
| >pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase From Sunflower Length = 440 | Back alignment and structure |
| >pdb|1ULQ|A Chain A, Crystal Structure Of Tt0182 From Thermus Thermophilus Hb8 Length = 401 | Back alignment and structure |
| >pdb|3GOA|A Chain A, Crystal Structure Of The Salmonella Typhimurium Fada 3- Ketoacyl-Coa Thiolase Length = 387 | Back alignment and structure |
| >pdb|1AFW|A Chain A, The 1.8 Angstrom Crystal Structure Of The Dimeric Peroxisomal Thiolase Of Saccharomyces Cerevisiae Length = 393 | Back alignment and structure |
| >pdb|1PXT|A Chain A, The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoacyl-Coa Thiolase Of Saccharomyces Cerevisiae: A Five Layered A-B-A- B-A Structure, Constructed From Two Core Domains Of Identical Topology Length = 390 | Back alignment and structure |
| >pdb|2IIK|A Chain A, Crystal Structure Of Human Peroxisomal Acetyl-Coa Acyl Transferase 1 (Acaa1) Length = 418 | Back alignment and structure |
| >pdb|2WKT|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316a Mutant With Coenzyme A. Length = 392 | Back alignment and structure |
| >pdb|2WKT|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316a Mutant With Coenzyme A Length = 392 | Back alignment and structure |
| >pdb|1WDK|C Chain C, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 390 | Back alignment and structure |
| >pdb|3SVK|A Chain A, Crystal Structure Of Acetyl-Coa Acetyltransferase From Mycobacterium Avium Length = 407 | Back alignment and structure |
| >pdb|2IBU|A Chain A, Crystallographic And Kinetic Studies Of Human Mitochondrial Acetoacetyl-coa Thiolase (t2): The Importance Of Potassium And Chloride For Its Structure And Function Length = 395 | Back alignment and structure |
| >pdb|2IB7|A Chain A, Crystallographic And Kinetic Studies Of Human Mitochondrial Acetoacetyl-Coa Thiolase (T2): The Importance Of Potassium And Chloride For Its Structure And Function Length = 395 | Back alignment and structure |
| >pdb|2F2S|A Chain A, Human Mitochondrial Acetoacetyl-Coa Thiolase Length = 406 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 1e-57 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 2e-57 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 3e-57 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 3e-57 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 3e-56 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 7e-52 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 8e-51 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 4e-50 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 8e-50 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 9e-49 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 1e-48 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 5e-48 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 1e-45 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 4e-05 |
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 | Back alignment and structure |
|---|
Score = 185 bits (472), Expect = 1e-57
Identities = 53/91 (58%), Positives = 66/91 (72%)
Query: 113 PTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAI 172
P +MGTGPIPA L +AGW ++DL E NEAFAAQ+ A ++LG D + VNV+GGAI
Sbjct: 285 PKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAI 344
Query: 173 ALGHPIGASGTRVLVTLLYALKRLNKSKGCA 203
A+GHPIGASG R+L TLL+ +KR KG A
Sbjct: 345 AIGHPIGASGARILNTLLFEMKRRGARKGLA 375
|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Length = 407 | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 99.91 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 99.91 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 99.91 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 99.91 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 99.9 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 99.9 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 99.9 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 99.89 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 99.89 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 99.89 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 99.88 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 99.88 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 99.87 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 99.87 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 99.12 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 99.11 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 99.0 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 98.95 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 98.89 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 98.88 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 98.76 | |
| 2ix4_A | 431 | 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke | 98.73 | |
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 98.71 | |
| 2iwz_A | 438 | 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho | 98.71 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 98.7 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 98.68 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 98.57 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 98.57 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 98.41 | |
| 2hg4_A | 917 | DEBS, 6-deoxyerythronolide B synthase; ketosynthas | 98.37 | |
| 3mqd_A | 428 | Beta-ketoacyl synthase; ssgcid, ALS collaborative | 98.37 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 98.31 | |
| 2vba_A | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop | 98.14 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 98.13 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 98.12 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 97.98 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 97.97 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 97.66 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 97.64 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 97.48 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 97.29 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 97.28 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 97.06 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 96.86 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 96.8 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 96.77 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 96.73 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 96.6 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 96.44 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 96.11 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 95.9 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 95.54 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 95.25 | |
| 4efi_A | 354 | 3-oxoacyl-(acyl-carrier protein) synthase; structu | 95.2 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 95.18 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 95.1 | |
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 94.84 | |
| 2d3m_A | 406 | Pentaketide chromone synthase; chalcone synthase, | 92.81 | |
| 3euo_A | 379 | Type III pentaketide synthase; alpha helix, acyltr | 92.55 | |
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 91.98 | |
| 3ov2_A | 393 | Curcumin synthase; type III polyketide synthase, t | 91.64 | |
| 1i88_A | 389 | CHS2, chalcone synthase 2; polyketide synthase, tr | 91.46 | |
| 3a5r_A | 387 | Benzalacetone synthase; chalcone synthase, type II | 91.39 | |
| 1ee0_A | 402 | 2-pyrone synthase; polyketide synthase, thiolase f | 91.12 | |
| 3awk_A | 402 | Chalcone synthase-like polyketide synthase; type I | 91.1 | |
| 2p0u_A | 413 | Stilbenecarboxylate synthase 2; polyketide synthas | 91.09 | |
| 3il6_A | 321 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 91.08 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 91.07 | |
| 3oit_A | 387 | OS07G0271500 protein; type III polyketide synthase | 90.93 | |
| 3e1h_A | 465 | PKSIIINC, putative uncharacterized protein; resorc | 90.93 | |
| 1xes_A | 413 | Dihydropinosylvin synthase; native structure, tran | 90.87 | |
| 3v7i_A | 413 | Putative polyketide synthase; type III polyketide | 90.8 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 90.67 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 90.66 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 90.42 | |
| 2d3m_A | 406 | Pentaketide chromone synthase; chalcone synthase, | 90.38 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 90.32 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 89.82 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 89.79 | |
| 4efi_A | 354 | 3-oxoacyl-(acyl-carrier protein) synthase; structu | 89.66 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 89.56 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 89.43 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 88.9 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 88.76 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 88.67 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 88.34 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 87.91 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 87.51 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 87.41 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 86.7 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 86.59 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 85.69 | |
| 1xpm_A | 396 | 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s | 85.52 | |
| 1i88_A | 389 | CHS2, chalcone synthase 2; polyketide synthase, tr | 85.43 | |
| 2v4w_A | 460 | Hydroxymethylglutaryl-COA synthase, mitochondrial; | 84.79 | |
| 2p0u_A | 413 | Stilbenecarboxylate synthase 2; polyketide synthas | 84.54 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 84.38 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 83.88 | |
| 1ee0_A | 402 | 2-pyrone synthase; polyketide synthase, thiolase f | 83.67 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 83.49 | |
| 3e1h_A | 465 | PKSIIINC, putative uncharacterized protein; resorc | 83.21 | |
| 3a5r_A | 387 | Benzalacetone synthase; chalcone synthase, type II | 83.14 | |
| 1xes_A | 413 | Dihydropinosylvin synthase; native structure, tran | 82.42 | |
| 2f82_A | 450 | HMG-COA synthase; HMGS1, transferase; 2.10A {Brass | 82.18 | |
| 3awk_A | 402 | Chalcone synthase-like polyketide synthase; type I | 81.56 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 81.31 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 80.99 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 80.86 | |
| 3v4n_A | 388 | HMG-COA synthase; hydroxymethylglutaryl-COA syntha | 80.67 | |
| 3euo_A | 379 | Type III pentaketide synthase; alpha helix, acyltr | 80.57 | |
| 2wya_A | 460 | Hydroxymethylglutaryl-COA synthase, mitochondrial; | 80.44 |
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
Probab=99.91 E-value=5.1e-25 Score=196.30 Aligned_cols=149 Identities=31% Similarity=0.516 Sum_probs=121.1
Q ss_pred hhhHHHHHHhhcccccCC--------------------CCCccccchHHHHHHHHhhcCCCceeeeec-----ccccccc
Q psy10774 49 RDVVEQILTTVSPFLEHP--------------------TNRRHALTSRQQVLLTLHWLGNGAQYHITA-----DAHGVSK 103 (207)
Q Consensus 49 ~~~~~~ll~~L~~~l~~~--------------------~~r~~a~~~~~q~L~aL~~~adGa~a~~la-----~~~gv~~ 103 (207)
+++..+-+..++|.+... .+..++.+++. ++||++++++. ++.|.++
T Consensus 215 ~~~t~e~l~~~~~vf~~~g~v~~~~~~~~~~~~~~~~i~~~~t~~~~s~--------~~DGAaavvL~s~~~A~~~g~~~ 286 (407)
T 3svk_A 215 PDTTMEGLAKLKTAFDGVGEMGGFDDVALQKYHWVEKINHVHTGGNSSG--------IVDGAALVLVGSEKAGKSQGLTP 286 (407)
T ss_dssp TTCCHHHHHTSCBSCC-------------CTTTTCSSCCCCCBTTTBCC--------BEEEEEEEEEECHHHHHHTTCCC
T ss_pred CCCCHHHHhhCCCeecCCCccccccccccccccccccccccccccccCc--------ccCceeEEEEeeHHHHHHcCCCC
Confidence 456666777777766531 11237888888 99999999985 3456555
Q ss_pred c----cccccccCCCccCCCchHHHHHHHHHcCCCCCCcceeeecccchHHHHHHHHHcCCCCCcccccCCcccCCCCCc
Q psy10774 104 S----TVQRTVHKPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAIALGHPIG 179 (207)
Q Consensus 104 ~----t~~~~~~~p~~~~~~~~~a~~~al~~ag~~~~did~~ei~d~fa~~~l~~~e~lGl~~~~vN~~GG~la~Ghp~g 179 (207)
. ++...+.+|..+..++..+++++|+++|++++|||++|+||+|+.+++.++|.||+|++|+|++||.+++|||+|
T Consensus 287 ~a~i~g~~~~~~~p~~~~~~~~~a~~~al~~Agl~~~dId~~e~hdaf~~~~l~~~~~lg~~~~~vn~~Gg~~~~GHp~g 366 (407)
T 3svk_A 287 RARIVATATSGSDPVIMLTGPTPATRKVLDRAGLTIDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHPLG 366 (407)
T ss_dssp CEEEEEEEEC------CCCTHHHHHHHHHHHHTCCGGGCSEEEECCSBHHHHHHHHHHHTCCGGGBSTTCCHHHHCBCGG
T ss_pred cEEEEEEEEeccCCccccHHHHHHHHHHHHHcCCCHHHCCEEEEeChhHHHHHHHHHHhCCCCCCCCCCCcHhheeCcHH
Confidence 2 333445677778888999999999999999999999999999999999999999999999999999999999999
Q ss_pred chHHHHHHHHHHHHHhcCCCeEEEee
Q psy10774 180 ASGTRVLVTLLYALKRLNKSKGCAVD 205 (207)
Q Consensus 180 asG~~~~~e~~~qL~~~~g~~gl~~~ 205 (207)
+||+++++++++||+++++++||+++
T Consensus 367 asG~~~~~~~~~~L~~~~~~~gl~~~ 392 (407)
T 3svk_A 367 ATGAMITGTMVDELERRNARRALITL 392 (407)
T ss_dssp GHHHHHHHHHHHHHHHHTCCEEEEEE
T ss_pred HHHHHHHHHHHHHHHhcCCCEEEEEe
Confidence 99999999999999999999999874
|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* | Back alignment and structure |
|---|
| >2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A | Back alignment and structure |
|---|
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A | Back alignment and structure |
|---|
| >2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* | Back alignment and structure |
|---|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
| >2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* | Back alignment and structure |
|---|
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
| >3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A | Back alignment and structure |
|---|
| >3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A | Back alignment and structure |
|---|
| >3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A | Back alignment and structure |
|---|
| >3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} | Back alignment and structure |
|---|
| >1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A | Back alignment and structure |
|---|
| >3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* | Back alignment and structure |
|---|
| >1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* | Back alignment and structure |
|---|
| >2p0u_A Stilbenecarboxylate synthase 2; polyketide synthase, PKS type transferase; 1.90A {Marchantia polymorpha} | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} | Back alignment and structure |
|---|
| >3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A | Back alignment and structure |
|---|
| >1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A | Back alignment and structure |
|---|
| >2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* | Back alignment and structure |
|---|
| >3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* | Back alignment and structure |
|---|
| >3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* | Back alignment and structure |
|---|
| >2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 207 | ||||
| d1m3ka2 | 124 | c.95.1.1 (A:269-392) Biosynthetic thiolase {Zooglo | 1e-31 | |
| d1ulqa2 | 125 | c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase | 2e-26 | |
| d1afwa2 | 124 | c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Sacc | 6e-26 | |
| d1wdkc2 | 128 | c.95.1.1 (C:264-391) Fatty oxidation complex beta | 5e-21 |
| >d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 124 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Biosynthetic thiolase species: Zoogloea ramigera [TaxId: 350]
Score = 110 bits (275), Expect = 1e-31
Identities = 53/91 (58%), Positives = 66/91 (72%)
Query: 113 PTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAI 172
P +MGTGPIPA L +AGW ++DL E NEAFAAQ+ A ++LG D + VNV+GGAI
Sbjct: 17 PKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAI 76
Query: 173 ALGHPIGASGTRVLVTLLYALKRLNKSKGCA 203
A+GHPIGASG R+L TLL+ +KR KG A
Sbjct: 77 AIGHPIGASGARILNTLLFEMKRRGARKGLA 107
|
| >d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 125 | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 128 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| d1m3ka2 | 124 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 99.96 | |
| d1ulqa2 | 125 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 99.96 | |
| d1afwa2 | 124 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 99.96 | |
| d1wdkc2 | 128 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 99.95 | |
| d1u6ea2 | 148 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 97.38 | |
| d1tqyb2 | 194 | Actinorhodin polyketide putative beta-ketoacyl syn | 97.23 | |
| d1ub7a2 | 149 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 97.01 | |
| d1tqya2 | 205 | Actinorhodin polyketide putative beta-ketoacyl syn | 96.67 | |
| d1hnja2 | 143 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 96.4 | |
| d1mzja2 | 153 | Priming beta-ketosynthase from the r1128 polyketid | 96.3 | |
| d1ox0a2 | 158 | Beta-ketoacyl-ACP synthase II {Streptococcus pneum | 96.08 | |
| d1u0ma2 | 148 | Putative polyketide synthase SCO1206 {Streptomyces | 95.87 | |
| d2gfva2 | 161 | Beta-ketoacyl-ACP synthase II {Escherichia coli [T | 95.6 | |
| d1e5ma2 | 161 | Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ | 95.54 | |
| d1j3na2 | 159 | Beta-ketoacyl-ACP synthase II {Thermus thermophilu | 95.34 | |
| d2ix4a2 | 161 | Beta-ketoacyl-ACP synthase II {Thale cress (Arabid | 94.31 | |
| d1u0ma1 | 200 | Putative polyketide synthase SCO1206 {Streptomyces | 93.58 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 93.55 | |
| d1wdkc1 | 262 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 93.21 | |
| d1afwa1 | 269 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 93.14 | |
| d1ub7a1 | 172 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 92.41 | |
| d1bi5a2 | 154 | Chalcone synthase {Alfalfa (Medicago sativa) [TaxI | 91.98 | |
| d1ulqa1 | 273 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 91.95 | |
| d1m3ka1 | 268 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 91.75 | |
| d1u0ua2 | 156 | Dihydropinosylvin synthase {Scots pine (Pinus sylv | 91.42 | |
| d1ee0a2 | 160 | Pyrone synthase (PyS, chalcone synthase 2) {Gerber | 91.02 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 90.47 | |
| d1hnja1 | 174 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 89.86 | |
| d1bi5a1 | 235 | Chalcone synthase {Alfalfa (Medicago sativa) [TaxI | 89.64 | |
| d1u6ea1 | 184 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 85.3 | |
| d1mzja1 | 181 | Priming beta-ketosynthase from the r1128 polyketid | 84.48 |
| >d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Biosynthetic thiolase species: Zoogloea ramigera [TaxId: 350]
Probab=99.96 E-value=1.5e-30 Score=193.50 Aligned_cols=101 Identities=52% Similarity=0.818 Sum_probs=97.5
Q ss_pred cccccccCCCccCCCchHHHHHHHHHcCCCCCCcceeeecccchHHHHHHHHHcCCCCCcccccCCcccCCCCCcchHHH
Q psy10774 105 TVQRTVHKPTLMGTGPIPAVNAVLAKAGWSKEEVDLFELNEAFAAQSIACLRELGLDEAKVNVSGGAIALGHPIGASGTR 184 (207)
Q Consensus 105 t~~~~~~~p~~~~~~~~~a~~~al~~ag~~~~did~~ei~d~fa~~~l~~~e~lGl~~~~vN~~GG~la~Ghp~gasG~~ 184 (207)
++...+.+|..|+.+|.+|++++|+++|++.+|||+||+||+|+.|.+.+.++||++++++|++||++++|||+|+||+|
T Consensus 9 ~~a~~g~dP~~mg~~Pv~A~~~lL~r~gl~~~Did~~EinEAFA~q~la~~~~l~id~~kvN~~GGaiAlGHP~GaSGar 88 (124)
T d1m3ka2 9 SWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGAR 88 (124)
T ss_dssp EEEEEECCGGGGGGTHHHHHHHHHHHHTCCGGGCSEEEECCSBHHHHHHHHHHHCCCGGGBSTTCCHHHHCCCTTTHHHH
T ss_pred EEEEEecChHHhccchHHHHHHHHHHcCCChhcccHHHhcccchhheeeehHhhCCChhhcCCCCCccccccCcCccchh
Confidence 45667899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhcCCCeEEEee
Q psy10774 185 VLVTLLYALKRLNKSKGCAVD 205 (207)
Q Consensus 185 ~~~e~~~qL~~~~g~~gl~~~ 205 (207)
++++++++|+.+++++|++++
T Consensus 89 l~~tl~~~L~~~~~~~Glas~ 109 (124)
T d1m3ka2 89 ILNTLLFEMKRRGARKGLATL 109 (124)
T ss_dssp HHHHHHHHHHHHTCSEEEEEE
T ss_pred HHHHHHHHHHhcCCCEEEEEe
Confidence 999999999999999999875
|
| >d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|
| >d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} | Back information, alignment and structure |
|---|
| >d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|