Diaphorina citri psyllid: psy10782


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MAGRSYNDLMQYPVLPFILSDYKSATLDLTDPKSFRNLKKPMAVQDKKNESHYVNNYNYLAREMCDAVGGVNQEPYHYGSHYSNSGTVLHFLVRIPPFTSMFLNS
ccccccccccccccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccHHHHccccc
MAGRSYNDLMQYPVLPFILSDYKSATLDLTDPKSFRNLKKPMAVQDKKNESHYVNNYNYLAREMCDAVGGVNQEPYHYGSHYSNSGTVLHFLVRIPPFTSMFLNS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGRSYNDLMQYPVLPFILSDYKSATLDLTDPKSFRNLKKPMAVQDKKNESHYVNNYNYLAREMCDAVGGVNQEPYHYGSHYSNSGTVLHFLVRIPPFTSMFLNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BEACH domain-containing protein lvsB Involved in negative regulation of lysosome biogenesis, by limiting the heterotypic fusion of early endosomes and postlysosomal compartments.confidentQ86JF2
Lysosomal-trafficking regulator May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.confidentQ9TTK4
Lysosomal-trafficking regulator May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.confidentQ99698

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0005545 [MF]1-phosphatidylinositol bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003831 [MF]beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activityprobableGO:0003674, GO:0035250, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0042267 [BP]natural killer cell mediated cytotoxicityprobableGO:0002376, GO:0045087, GO:0006955, GO:0006952, GO:0002449, GO:0006950, GO:0002228, GO:0001909, GO:0002252, GO:0008150, GO:0001906, GO:0002443, GO:0050896, GO:0044699
GO:0019898 [CC]extrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0007040 [BP]lysosome organizationprobableGO:0006996, GO:0007033, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0043473 [BP]pigmentationprobableGO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005776 [CC]autophagic vacuoleprobableGO:0005737, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032940 [BP]secretion by cellprobableGO:0046903, GO:0006810, GO:0009987, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0032510 [BP]endosome to lysosome transport via multivesicular body sorting pathwayprobableGO:0016197, GO:0006810, GO:0016192, GO:0046907, GO:0032509, GO:0051179, GO:0044765, GO:0008150, GO:0051641, GO:0051649, GO:0044763, GO:0009987, GO:0051234, GO:0045022, GO:0044699, GO:0016482
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T77, chain A
Confidence level:very confident
Coverage over the Query: 1-104
View the alignment between query and template
View the model in PyMOL