Diaphorina citri psyllid: psy10795


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MVQIALGTLLQGLNFGTVDKIFIRFPAKWWKDGCQGFNLYWTQQDKTDLFKDMVHVDGKPWVWGILGFYMDAEDPLTLLVSGQTPVDLSNKILYKKEVNKIDWEYQNGAAVSCSDGSVYTAYKIIITVPLGVLKSKLITFVPSLPAQKLNAIEGLNFGTVDKIFIRFPAKWWKDGCQGFNFYWTQQDKMDLFKDMVHVDGKPWVWGILGFYMDAEDPLTLLGWIAGPTARYMETLPMAVLQADIMRLFRHFLGGAYIIPEPIRIVRSAWSINPHFRGSYSHHGPTQHQCRRLGRSSYQQRRPPRAPLCRRSYQPTSLRNGSDRLNTSAADLAAPVINREGRPVLLFAGEATSPHHYGTVNGAVESGARETANAIVYLRREGFFEKLVNIAVKELEHKGNQVGRILNLFGGGI
cHHHHHHHHHHccccccccCEEEEEcccccccccccccCECcccccccccccccEEccccCECcccccEEcccccHHHcccccccccccccEEccccEEEEEEcccccEEEEEccccEEEccEEEEEccHHHHccccccccccccHHHHHHHHccccccccEEEEEccccccccccccEEEEEccccccccccccccccccccEEEEEEEECccccccEEEEEccccHHHHHccccHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHccccc
***IALGTLLQGLNFGTVDKIFIRFPAKWWKDGCQGFNLYWTQQDKTDLFKDMVHVDGKPWVWGILGFYMDAEDPLTLLVSGQTPVDLSNKILYKKEVNKIDWEYQNGAAVSCSDGSVYTAYKIIITVPLGVLKSKLITFVPSLPAQKLNAIEGLNFGTVDKIFIRFPAKWWKDGCQGFNFYWTQQDKMDLFKDMVHVDGKPWVWGILGFYMDAEDPLTLLGWIAGPTARYMETLPMAVLQADIMRLFRHFLGGAYIIPEPIRIVRSAWSINPHFRGSYSHHGPTQHQCRRLGRSSYQQRRPPRAPLCRRSYQP****NGSDRLNTSAADLAAPVINREGRPVLLFAGEATSPHHYGTVNGAVESGARETANAIVYLRREGFFEKLVNIAVKELEHKGNQVGRILNLFGGGI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQIALGTLLQGLNFGTVDKIFIRFPAKWWKDGCQGFNLYWTQQDKTDLFKDMVHVDGKPWVWGILGFYMDAEDPLTLLVSGQTPVDLSNKILYKKEVNKIDWEYQNGAAVSCSDGSVYTAYKIIITVPLGVLKSKLITFVPSLPAQKLNAIEGLNFGTVDKIFIRFPAKWWKDGCQGFNFYWTQQDKMDLFKDMVHVDGKPWVWGILGFYMDAEDPLTLLGWIAGPTARYMETLPMAVLQADIMRLFRHFLGGAYIIPEPIRIVRSAWSINPHFRGSYSHHGPTQHQCRRLGRSSYQQRRPPRAPLCRRSYQPTSLRNGSDRLNTSAADLAAPVINREGRPVLLFAGEATSPHHYGTVNGAVESGARETANAIVYLRREGFFEKLVNIAVKELEHKGNQVGRILNLFGGGI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008152 [BP]metabolic processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RSG, chain A
Confidence level:very confident
Coverage over the Query: 78-286,329-380
View the alignment between query and template
View the model in PyMOL
Template: 1RSG, chain A
Confidence level:very confident
Coverage over the Query: 5-44
View the alignment between query and template
View the model in PyMOL
Template: 4GDE, chain A
Confidence level:confident
Coverage over the Query: 13-282,314-375
View the alignment between query and template
View the model in PyMOL
Template: 2EJR, chain A
Confidence level:probable
Coverage over the Query: 112-180,197-298,314-315,342-370
View the alignment between query and template
View the model in PyMOL