Diaphorina citri psyllid: psy10800


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS
ccccccccccHHHHHHHHHHHccccccccccccccccEEcccccHHHHHHHHHHHHHcccccccccccccccccEEEEccc
***********EVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase BRE1A Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role in histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator.confidentA2VDP1
E3 ubiquitin-protein ligase BRE1A Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role in histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator.confidentQ5DTM8
E3 ubiquitin-protein ligase Bre1 E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-117' of histone H2B. H2B 'Lys-117' ubiquitination gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It thereby plays a central role in histone code and gene regulation. Required for the expression of Notch target genes in development by affecting the levels of Su(H) in imaginal disk cells and stimulating the Su(H)-mediated transcription of Notch-specific genes.confidentQ9VRP9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0035518 [BP]histone H2A monoubiquitinationprobableGO:0010390, GO:0044699, GO:0044267, GO:0033522, GO:0044260, GO:0016574, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0032446, GO:0016570, GO:0009987, GO:0006464, GO:0071704, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006513, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0033523 [BP]histone H2B ubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0002039 [MF]p53 bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030336 [BP]negative regulation of cell migrationprobableGO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0035102 [CC]PRC1 complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0031519, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0033503 [CC]HULC complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0000792, GO:0043229, GO:0043228, GO:0000785, GO:0043226, GO:0044424, GO:0044427, GO:0005694, GO:0031371, GO:0044422
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JM7, chain A
Confidence level:very confident
Coverage over the Query: 8-77
View the alignment between query and template
View the model in PyMOL