Psyllid ID: psy10800

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80-

MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

ccccccccccHHHHHHHHHHHccccccccccccccccEEcccccHHHHHHHHHHHHHcccccccccccccccccEEEEccc

cccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEcccEccHHHHHHHHHHHHHHcccccccccccccEEEEEcc

mkkieqagtldEVMLEEIREYKetltcpsckvkrkdavltkcfHVFCWDCLRTRYetrqrkcpkcnaafgandyhrlylgs

mkkieqagtldevmLEEIREYketltcpsckvkrkdavltkcFHVFCWDCLRTRyetrqrkcpkcnaafgandyhrlylgs

MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

***********EVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYL**

*********************KETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

******AGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLGS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		81	2.2.26 [Sep-21-2011]
Q9VRP9		1044	E3 ubiquitin-protein liga	yes	N/A	0.975	0.075	0.887	3e-39
A2VDP1		975	E3 ubiquitin-protein liga	yes	N/A	0.864	0.071	0.714	9e-30
Q5VTR2		975	E3 ubiquitin-protein liga	yes	N/A	0.864	0.071	0.714	1e-29
Q5ZLS3		984	E3 ubiquitin-protein liga	yes	N/A	0.864	0.071	0.714	1e-29
Q5DTM8		973	E3 ubiquitin-protein liga	yes	N/A	0.864	0.071	0.714	1e-29
O75150		1001	E3 ubiquitin-protein liga	no	N/A	0.962	0.077	0.653	5e-28
Q4R7K7		1001	E3 ubiquitin-protein liga	N/A	N/A	0.962	0.077	0.653	5e-28
Q5RAU7		1001	E3 ubiquitin-protein liga	no	N/A	0.962	0.077	0.653	6e-28
Q8CJB9		1002	E3 ubiquitin-protein liga	no	N/A	0.962	0.077	0.653	7e-28
Q3U319		1001	E3 ubiquitin-protein liga	no	N/A	0.962	0.077	0.653	7e-28

>sp\|Q9VRP9\|BRE1_DROME E3 ubiquitin-protein ligase Bre1 OS=Drosophila melanogaster GN=Bre1 PE=1 SV=2	Back alignment and function desciption

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 71/80 (88%), Positives = 77/80 (96%), Gaps = 1/80 (1%)

Query: 1    MKKIEQAGT-LDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQ 59
            MKK+E +GT +DEVM+EEIREYKETLTCPSCKVKRKDAVL+KCFHVFC+DCLRTRYETRQ
Sbjct: 964  MKKMEMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQ 1023

Query: 60   RKCPKCNAAFGANDYHRLYL 79
            RKCPKCN AFGANDYHRLYL
Sbjct: 1024 RKCPKCNCAFGANDYHRLYL 1043

E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-117' of histone H2B. H2B 'Lys-117' ubiquitination gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It thereby plays a central role in histone code and gene regulation. Required for the expression of Notch target genes in development by affecting the levels of Su(H) in imaginal disk cells and stimulating the Su(H)-mediated transcription of Notch-specific genes.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|A2VDP1\|BRE1A_BOVIN E3 ubiquitin-protein ligase BRE1A OS=Bos taurus GN=RNF20 PE=2 SV=1	Back alignment and function description

>sp\|Q5VTR2\|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens GN=RNF20 PE=1 SV=2	Back alignment and function description

>sp\|Q5ZLS3\|BRE1A_CHICK E3 ubiquitin-protein ligase BRE1A OS=Gallus gallus GN=RNF20 PE=2 SV=1	Back alignment and function description

>sp\|Q5DTM8\|BRE1A_MOUSE E3 ubiquitin-protein ligase BRE1A OS=Mus musculus GN=Rnf20 PE=1 SV=2	Back alignment and function description

>sp\|O75150\|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens GN=RNF40 PE=1 SV=4	Back alignment and function description

>sp\|Q4R7K7\|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1	Back alignment and function description

>sp\|Q5RAU7\|BRE1B_PONAB E3 ubiquitin-protein ligase BRE1B OS=Pongo abelii GN=RNF40 PE=2 SV=1	Back alignment and function description

>sp\|Q8CJB9\|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1	Back alignment and function description

>sp\|Q3U319\|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		81
193678945		953	PREDICTED: e3 ubiquitin-protein ligase B	1.0	0.084	0.975	6e-44
242006288		989	ubiquitin-protein ligase BRE1A, putative	0.987	0.080	0.937	2e-40
357624659		915	hypothetical protein KGM_09234 [Danaus p	1.0	0.088	0.902	3e-40
328778821		930	PREDICTED: e3 ubiquitin-protein ligase B	1.0	0.087	0.913	1e-39
307199111		957	E3 ubiquitin-protein ligase Bre1 [Harpeg	1.0	0.084	0.913	1e-39
380030127		953	PREDICTED: E3 ubiquitin-protein ligase B	1.0	0.084	0.913	1e-39
350402387		957	PREDICTED: E3 ubiquitin-protein ligase B	1.0	0.084	0.913	1e-39
383857052		957	PREDICTED: E3 ubiquitin-protein ligase B	1.0	0.084	0.913	1e-39
332020263		676	E3 ubiquitin-protein ligase Bre1 [Acromy	1.0	0.119	0.913	1e-39
340711825		957	PREDICTED: e3 ubiquitin-protein ligase B	1.0	0.084	0.913	1e-39

>gi\|193678945\|ref\|XP_001949533.1\| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 79/81 (97%), Positives = 80/81 (98%)

Query: 1   MKKIEQAGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQR 60
           MKKIEQAGTLDEVM+EEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQR
Sbjct: 873 MKKIEQAGTLDEVMVEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQR 932

Query: 61  KCPKCNAAFGANDYHRLYLGS 81
           KCPKCNA FGANDYHRLYLGS
Sbjct: 933 KCPKCNATFGANDYHRLYLGS 953

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|242006288\|ref\|XP_002423984.1\| ubiquitin-protein ligase BRE1A, putative [Pediculus humanus corporis] gi\|212507266\|gb\|EEB11246.1\| ubiquitin-protein ligase BRE1A, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|357624659\|gb\|EHJ75355.1\| hypothetical protein KGM_09234 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|328778821\|ref\|XP_625025.3\| PREDICTED: e3 ubiquitin-protein ligase Bre1, partial [Apis mellifera]	Back alignment and taxonomy information

>gi\|307199111\|gb\|EFN79821.1\| E3 ubiquitin-protein ligase Bre1 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|380030127\|ref\|XP_003698707.1\| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Apis florea]	Back alignment and taxonomy information

>gi\|350402387\|ref\|XP_003486466.1\| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|383857052\|ref\|XP_003704020.1\| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|332020263\|gb\|EGI60697.1\| E3 ubiquitin-protein ligase Bre1 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|340711825\|ref\|XP_003394469.1\| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Bombus terrestris]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		81
FB\|FBgn0086694		1044	Bre1 "Bre1" [Drosophila melano	0.975	0.075	0.887	7.4e-36
UNIPROTKB\|F1N9A6		984	RNF20 "E3 ubiquitin-protein li	0.975	0.080	0.658	1.6e-28
UNIPROTKB\|Q5ZLS3		984	RNF20 "E3 ubiquitin-protein li	0.975	0.080	0.658	1.6e-28
MGI\|MGI:1925927		973	Rnf20 "ring finger protein 20"	0.975	0.081	0.658	2e-28
RGD\|1311936		973	Rnf20 "ring finger protein 20,	0.975	0.081	0.658	2e-28
UNIPROTKB\|A2VDP1		975	RNF20 "E3 ubiquitin-protein li	0.975	0.081	0.658	2e-28
UNIPROTKB\|F6XUF9		975	RNF20 "Uncharacterized protein	0.975	0.081	0.658	2e-28
UNIPROTKB\|Q5VTR2		975	RNF20 "E3 ubiquitin-protein li	0.975	0.081	0.658	2e-28
UNIPROTKB\|F1SSB0		975	LOC100154259 "Uncharacterized	0.975	0.081	0.658	2e-28
UNIPROTKB\|E2QZB1		977	RNF20 "Uncharacterized protein	0.975	0.080	0.658	2.1e-28

FB\|FBgn0086694 Bre1 "Bre1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 398 (145.2 bits), Expect = 7.4e-36, P = 7.4e-36
 Identities = 71/80 (88%), Positives = 77/80 (96%)

Query:     1 MKKIEQAGT-LDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQ 59
             MKK+E +GT +DEVM+EEIREYKETLTCPSCKVKRKDAVL+KCFHVFC+DCLRTRYETRQ
Sbjct:   964 MKKMEMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQ 1023

Query:    60 RKCPKCNAAFGANDYHRLYL 79
             RKCPKCN AFGANDYHRLYL
Sbjct:  1024 RKCPKCNCAFGANDYHRLYL 1043

GO:0008270 "zinc ion binding" evidence=IEA

GO:0016570 "histone modification" evidence=IMP

GO:0007422 "peripheral nervous system development" evidence=NAS

GO:0006911 "phagocytosis, engulfment" evidence=IMP

UNIPROTKB\|F1N9A6 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZLS3 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1925927 Rnf20 "ring finger protein 20" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1311936 Rnf20 "ring finger protein 20, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|A2VDP1 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F6XUF9 RNF20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5VTR2 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SSB0 LOC100154259 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QZB1 RNF20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q5DTM8	BRE1A_MOUSE	6, ., 3, ., 2, ., -	0.7142	0.8641	0.0719	yes	N/A
P34537	BRE1_CAEEL	6, ., 3, ., 2, ., -	0.5753	0.9012	0.0872	yes	N/A
Q5ZLS3	BRE1A_CHICK	6, ., 3, ., 2, ., -	0.7142	0.8641	0.0711	yes	N/A
Q9VRP9	BRE1_DROME	6, ., 3, ., 2, ., -	0.8875	0.9753	0.0756	yes	N/A
A2VDP1	BRE1A_BOVIN	6, ., 3, ., 2, ., -	0.7142	0.8641	0.0717	yes	N/A
Q5VTR2	BRE1A_HUMAN	6, ., 3, ., 2, ., -	0.7142	0.8641	0.0717	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		81
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	9e-06
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	6e-05
smart00184		40	smart00184, RING, Ring finger	7e-05
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	1e-04
COG5222		427	COG5222, COG5222, Uncharacterized conserved protei	7e-04
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	0.001
COG5432		391	COG5432, RAD18, RING-finger-containing E3 ubiquiti	0.002
COG5574		271	COG5574, PEX10, RING-finger-containing E3 ubiquiti	0.004

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

 Score = 38.6 bits (90), Expect = 9e-06
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 26 TCPSCK-VKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAF 69
           CP C    R+  VL  C HVFC  C+    ++ +  CP C    
Sbjct: 1  ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45

Length = 45

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		81
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.68
KOG0978\|consensus		698		99.67
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.64
KOG0320\|consensus		187		99.62
KOG0823\|consensus		230		99.59
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.54
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	99.52
KOG0317\|consensus		293		99.5
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	99.47
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	99.44
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.43
PHA02929		238	N1R/p28-like protein; Provisional	99.42
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	99.41
KOG0287\|consensus		442		99.39
KOG2164\|consensus		513		99.38
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	99.36
PF14634		44	zf-RING_5: zinc-RING finger domain	99.35
PHA02926		242	zinc finger-like protein; Provisional	99.35
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.34
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	99.31
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	99.3
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	99.23
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	99.16
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	99.15
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	99.15
KOG2177\|consensus		386		99.09
KOG4628\|consensus		348		99.04
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	99.04
KOG0311\|consensus		381		98.95
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	98.91
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.9
KOG0802\|consensus		543		98.82
KOG0824\|consensus		324		98.77
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.76
KOG4172\|consensus		62		98.66
KOG4159\|consensus		398		98.61
KOG2660\|consensus		331		98.6
KOG4265\|consensus		349		98.58
COG5152		259	Uncharacterized conserved protein, contains RING a	98.56
COG5222		427	Uncharacterized conserved protein, contains RING Z	98.42
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	98.41
KOG0297\|consensus		391		98.31
KOG2879\|consensus		298		98.28
KOG1813\|consensus		313		98.23
KOG1039\|consensus		344		98.17
KOG0804\|consensus		493		98.16
KOG0828\|consensus		636		98.13
KOG3039\|consensus		303		98.12
PF04641		260	Rtf2: Rtf2 RING-finger	98.12
KOG1785\|consensus		563		98.12
KOG2817\|consensus		394		98.11
KOG1645\|consensus		463		98.06
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	98.06
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	98.0
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	97.96
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	97.95
KOG1493\|consensus		84		97.92
KOG4367\|consensus		699		97.91
KOG1734\|consensus		328		97.88
KOG0827\|consensus		465		97.88
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	97.88
KOG4275\|consensus		350		97.84
COG5219		1525	Uncharacterized conserved protein, contains RING Z	97.83
KOG4185\|consensus		296		97.82
KOG1002\|consensus		791		97.81
KOG3800\|consensus		300		97.79
KOG4692\|consensus		489		97.71
KOG0826\|consensus		357		97.69
KOG4739\|consensus		233		97.53
KOG3002\|consensus		299		97.48
KOG1814\|consensus		445		97.48
KOG1001\|consensus		674		97.46
KOG0825\|consensus		1134		97.41
COG5175		480	MOT2 Transcriptional repressor [Transcription]	97.37
KOG2930\|consensus		114		97.37
KOG1941\|consensus		518		97.36
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	97.29
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	97.23
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	97.02
KOG1571\|consensus		355		97.01
COG5109		396	Uncharacterized conserved protein, contains RING Z	97.01
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	96.99
COG5236		493	Uncharacterized conserved protein, contains RING Z	96.99
KOG2114\|consensus		933		96.77
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	96.68
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	96.68
KOG4362\|consensus		684		96.63
KOG3970\|consensus		299		96.33
PHA03096		284	p28-like protein; Provisional	96.13
KOG1940\|consensus		276		95.96
KOG3268\|consensus		234		95.74
KOG1952\|consensus		950		95.67
KOG2932\|consensus		389		95.67
KOG1812\|consensus		384		95.62
KOG3113\|consensus		293		95.54
KOG4445\|consensus		368		95.51
KOG1815\|consensus		444		95.43
KOG3161\|consensus		861		95.36
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	95.3
KOG0298\|consensus		1394		95.13
KOG1100\|consensus		207		95.1
KOG1428\|consensus		3738		94.88
PHA02825		162	LAP/PHD finger-like protein; Provisional	94.74
KOG3899\|consensus		381		94.72
KOG3039\|consensus		303		94.6
KOG2034\|consensus		911		94.33
PF03854		50	zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc	94.04
PHA02862		156	5L protein; Provisional	93.94
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	93.8
PF06906		57	DUF1272: Protein of unknown function (DUF1272); In	93.79
KOG3579\|consensus		352		93.65
COG3813		84	Uncharacterized protein conserved in bacteria [Fun	92.87
PF14446		54	Prok-RING_1: Prokaryotic RING finger family 1	91.84
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	91.74
PF07975		51	C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al	91.7
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	90.42
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	90.33
PF10235		90	Cript: Microtubule-associated protein CRIPT; Inter	89.77
KOG1812\|consensus		384		89.72
PF14353		128	CpXC: CpXC protein	89.45
PF14569		80	zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A.	88.16
KOG2979\|consensus		262		87.23
KOG0309\|consensus		1081		86.92
PF05605		54	zf-Di19: Drought induced 19 protein (Di19), zinc-b	85.88
KOG4718\|consensus		235		84.68
KOG4185\|consensus		296		83.95
KOG2462\|consensus		279		83.72
PF06844		68	DUF1244: Protein of unknown function (DUF1244); In	83.48
KOG0289\|consensus		506		83.25
KOG2068\|consensus		327		82.17
PF12773		50	DZR: Double zinc ribbon	81.97
PF04216		290	FdhE: Protein involved in formate dehydrogenase fo	81.93
cd00350		33	rubredoxin_like Rubredoxin_like; nonheme iron bind	81.48
cd00065		57	FYVE FYVE domain; Zinc-binding domain; targets pro	80.83
PF10497		105	zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida	80.21

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

Probab=99.68  E-value=4e-17  Score=97.41  Aligned_cols=61  Identities=26%  Similarity=0.651  Sum_probs=52.4

Q ss_pred             HhcCCcccCccCccCccCceecCCCChhHHHHHHHHHhh---------------CCCCCCCCCcCcCcCCceeeec
Q psy10800         19 REYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYET---------------RQRKCPKCNAAFGANDYHRLYL   79 (81)
Q Consensus        19 ~~~~~~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~~---------------~~~~CP~Cr~~~~~~~~~~~~~   79 (81)
                      ......+.|+||++.+.+|++++|||.||+.||.+|+..               ....||.||..+...++.++|-
T Consensus        13 ~~~~~~~~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~~~LvPiyg   88 (193)
T PLN03208         13 VDSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATLVPIYG   88 (193)
T ss_pred             ccCCCccCCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCChhcEEEeec
Confidence            344567999999999999999999999999999999853               1246999999999999998874

>KOG0978\|consensus	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0320\|consensus	Back alignment and domain information

>KOG0823\|consensus	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG0317\|consensus	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0287\|consensus	Back alignment and domain information

>KOG2164\|consensus	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2177\|consensus	Back alignment and domain information

>KOG4628\|consensus	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0311\|consensus	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0802\|consensus	Back alignment and domain information

>KOG0824\|consensus	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4172\|consensus	Back alignment and domain information

>KOG4159\|consensus	Back alignment and domain information

>KOG2660\|consensus	Back alignment and domain information

>KOG4265\|consensus	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG0297\|consensus	Back alignment and domain information

>KOG2879\|consensus	Back alignment and domain information

>KOG1813\|consensus	Back alignment and domain information

>KOG1039\|consensus	Back alignment and domain information

>KOG0804\|consensus	Back alignment and domain information

>KOG0828\|consensus	Back alignment and domain information

>KOG3039\|consensus	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG1785\|consensus	Back alignment and domain information

>KOG2817\|consensus	Back alignment and domain information

>KOG1645\|consensus	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG1493\|consensus	Back alignment and domain information

>KOG4367\|consensus	Back alignment and domain information

>KOG1734\|consensus	Back alignment and domain information

>KOG0827\|consensus	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4275\|consensus	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG4185\|consensus	Back alignment and domain information

>KOG1002\|consensus	Back alignment and domain information

>KOG3800\|consensus	Back alignment and domain information

>KOG4692\|consensus	Back alignment and domain information

>KOG0826\|consensus	Back alignment and domain information

>KOG4739\|consensus	Back alignment and domain information

>KOG3002\|consensus	Back alignment and domain information

>KOG1814\|consensus	Back alignment and domain information

>KOG1001\|consensus	Back alignment and domain information

>KOG0825\|consensus	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG2930\|consensus	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG1571\|consensus	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4362\|consensus	Back alignment and domain information

>KOG3970\|consensus	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG1940\|consensus	Back alignment and domain information

>KOG3268\|consensus	Back alignment and domain information

>KOG1952\|consensus	Back alignment and domain information

>KOG2932\|consensus	Back alignment and domain information

>KOG1812\|consensus	Back alignment and domain information

>KOG3113\|consensus	Back alignment and domain information

>KOG4445\|consensus	Back alignment and domain information

>KOG1815\|consensus	Back alignment and domain information

>KOG3161\|consensus	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>KOG0298\|consensus	Back alignment and domain information

>KOG1100\|consensus	Back alignment and domain information

>KOG1428\|consensus	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>KOG3899\|consensus	Back alignment and domain information

>KOG3039\|consensus	Back alignment and domain information

>KOG2034\|consensus	Back alignment and domain information

>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length	Back alignment and domain information

>KOG3579\|consensus	Back alignment and domain information

>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF14446 Prok-RING_1: Prokaryotic RING finger family 1	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production	Back alignment and domain information

>KOG1812\|consensus	Back alignment and domain information

>PF14353 CpXC: CpXC protein	Back alignment and domain information

>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A	Back alignment and domain information

>KOG2979\|consensus	Back alignment and domain information

>KOG0309\|consensus	Back alignment and domain information

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins	Back alignment and domain information

>KOG4718\|consensus	Back alignment and domain information

>KOG4185\|consensus	Back alignment and domain information

>KOG2462\|consensus	Back alignment and domain information

>PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length	Back alignment and domain information

>KOG0289\|consensus	Back alignment and domain information

>KOG2068\|consensus	Back alignment and domain information

>PF12773 DZR: Double zinc ribbon	Back alignment and domain information

>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []	Back alignment and domain information

>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center	Back alignment and domain information

>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;	Back alignment and domain information

>PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		81
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	2e-11
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	1e-10
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-10
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	1e-09
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	3e-08
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	4e-08
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	1e-07
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	3e-07
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	4e-07
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	6e-07
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	7e-07
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	1e-06
1z6u_A		150	NP95-like ring finger protein isoform B; structura	2e-06
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	2e-06
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	2e-06
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	3e-06
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	4e-06
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	6e-06
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	7e-06
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	1e-05
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	1e-05
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	1e-05
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	1e-05
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	2e-05
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	2e-05
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	3e-05
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	3e-05
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	5e-05
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	7e-05
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	9e-05
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	1e-04
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	1e-04
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	2e-04
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	6e-04

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

 Score = 56.7 bits (136), Expect = 2e-11
 Identities = 14/63 (22%), Positives = 20/63 (31%)

Query: 11  DEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFG 70
            E              C  C    KD  +  C H+ C  CL +  E+  + CP C     
Sbjct: 319 QEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIK 378

Query: 71  AND 73
             +
Sbjct: 379 GTE 381

PyMOL of 2y1n

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		81
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.77
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.76
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.75
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.74
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.74
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.73
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.73
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.72
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.72
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.71
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.71
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.7
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.7
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.7
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.7
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.69
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.68
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.66
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	99.66
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.66
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.66
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.66
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.65
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	99.65
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	99.65
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.65
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.65
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.64
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.64
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.63
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.63
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	99.62
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	99.62
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.62
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	99.61
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	99.61
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	99.59
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.59
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	99.59
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.58
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.58
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	99.58
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.58
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.57
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.57
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.56
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.55
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	99.55
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.54
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.54
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.53
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	99.53
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	99.52
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.51
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	99.51
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.5
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	99.5
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.46
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	99.45
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	99.38
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	99.35
2ea5_A		68	Cell growth regulator with ring finger domain prot	99.35
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	99.33
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	99.32
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	99.22
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	99.14
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	99.13
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.96
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	98.85
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.63
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	98.53
3nw0_A		238	Non-structural maintenance of chromosomes element	97.77
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	97.76
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	97.6
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	95.84
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	95.01
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	94.88
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	93.45
1z60_A		59	TFIIH basal transcription factor complex P44 subun	92.06
3mjh_B		34	Early endosome antigen 1; protein-zinc finger comp	90.58
1weo_A		93	Cellulose synthase, catalytic subunit (IRX3); stru	90.3
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	88.86
1m3v_A		122	FLIN4, fusion of the LIM interacting domain of LDB	88.16
1vfy_A		73	Phosphatidylinositol-3-phosphate binding FYVE doma	87.76
2rgt_A		169	Fusion of LIM/homeobox protein LHX3, linker, INSU	86.85
2xqn_T		126	Testin, TESS; metal-binding protein, cytoskeleton,	86.76
1wil_A		89	KIAA1045 protein; ring finger domain, structural g	86.49
2yw8_A		82	RUN and FYVE domain-containing protein 1; structur	84.71
2lbm_A		142	Transcriptional regulator ATRX; metal binding prot	84.37
1joc_A		125	EEA1, early endosomal autoantigen 1; FYVE domain,	84.26
1z2q_A		84	LM5-1; membrane protein, FYVE domain, zinc-finger;	84.11
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	83.19
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	82.97
1x4u_A		84	Zinc finger, FYVE domain containing 27 isoform B;	82.89
2jtn_A		182	LIM domain-binding protein 1, LIM/homeobox protein	81.57
1wfk_A		88	Zinc finger, FYVE domain containing 19; riken stru	81.24

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

Probab=99.77  E-value=1.8e-19  Score=97.65  Aligned_cols=65  Identities=23%  Similarity=0.567  Sum_probs=56.3

Q ss_pred             HHHHHHhcCCcccCccCccCccCcee-cCCCChhHHHHHHHHHhhCCCCCCCCCcCcCcCCceeee
Q psy10800         14 MLEEIREYKETLTCPSCKVKRKDAVL-TKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLY   78 (81)
Q Consensus        14 ~~~~~~~~~~~~~C~iC~~~~~~~~~-~~CgH~fc~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~   78 (81)
                      .......+.+.+.|+||++.+.+|+. ++|||+||..||.+|+......||.||..+...++...+
T Consensus        12 ~~~~~~~l~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~l~~~~   77 (100)
T 3lrq_A           12 DEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCR   77 (100)
T ss_dssp             HHHHHHHHHHHTBCTTTCSBCSSEEECTTTCCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCEECT
T ss_pred             cccccccCCCCCCCccCCccccCccccCCCCChhhHHHHHHHHHHCcCCCCCCCCcCCHHHhHhhH
Confidence            34456677889999999999999999 999999999999999997657899999999887776653

PyMOL of 3lrq

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2	Back alignment and structure

>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens}	Back alignment and structure

>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3	Back alignment and structure

>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1	Back alignment and structure

>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A	Back alignment and structure

>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens}	Back alignment and structure

>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3	Back alignment and structure

>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A	Back alignment and structure

>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A	Back alignment and structure

>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A	Back alignment and structure

>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major}	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A*	Back alignment and structure

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus}	Back alignment and structure

>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		81
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	1e-11
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	1e-07
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	2e-07
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	4e-06
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	7e-05
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	7e-04
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	0.001
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	0.002

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 53.0 bits (127), Expect = 1e-11
 Identities = 14/54 (25%), Positives = 23/54 (42%)

Query: 20 EYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGAND 73
           + ++++C  C+    D V T C H+FC  C+    +     CP C       D
Sbjct: 19 HFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTD 72

PyMOL of d1rmda2

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		81
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.8
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.79
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.77
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.74
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.74
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.73
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.71
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.67
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.63
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.6
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.59
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	99.59
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.51
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	99.43
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	99.36
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	99.25
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.8
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	96.25
d1z60a1		59	TFIIH p44 subunit cysteine-rich domain {Human (Hom	93.69
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	91.27
d1weoa_		93	Cellulose synthase A catalytic subunit 7, IRX3 {Th	89.62
d1wila_		89	Hypothetical protein KIAA1045 {Human (Homo sapiens	89.47
d2epqa1		32	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	86.48
d1vfya_		67	vps27p protein {Baker's yeast (Saccharomyces cerev	85.07
d1joca1		64	Eea1 {Human (Homo sapiens) [TaxId: 9606]}	83.33
d2dlqa3		30	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	83.11
d1dvpa2		72	Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7	81.9
d2jnea1		71	Hypothetical protein YfgJ {Escherichia coli [TaxId	81.4
d2dloa1		35	Thyroid receptor interacting protein 6, TRIP6 {Hum	80.07

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.80  E-value=1.2e-20  Score=101.57  Aligned_cols=71  Identities=25%  Similarity=0.522  Sum_probs=58.7

Q ss_pred             cCCchHHHHHHHHhcCCcccCccCccCccCceecCCCChhHHHHHHHHHhhCC--CCCCCCCcCcCcCCceee
Q psy10800          7 AGTLDEVMLEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQ--RKCPKCNAAFGANDYHRL   77 (81)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~--~~CP~Cr~~~~~~~~~~~   77 (81)
                      .+...+........+++.+.||||++.+.+|+.++|||+||..|+.+|+....  ..||.||..+...++...
T Consensus         4 ~~~~~~~~~~~~~~l~~~l~CpIC~~~~~~pv~~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~~~~l~~n   76 (103)
T d1jm7a_           4 SALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQES   76 (103)
T ss_dssp             GGSSHHHHHHHHHHHHHHTSCSSSCCCCSSCCBCTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCCTTTCBCC
T ss_pred             chhhHHHHHHHHHhcccCcCCCccCchhCCeEEcCCCCchhhHHHHHHHHHCCCCCcCcCCCCcCChhhCCcC
Confidence            34445666667778888899999999999999999999999999999997543  479999999987776543

PyMOL of d1jm7a_

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure