Diaphorina citri psyllid: psy10801


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MDGSADGTQYSADRILITVSLGVLKSNLITFVPPLPPKNLNAIKGLAVETSVLYFVLFQGLAFGTIDKIFIRFPKKWWPEDYQGFHFFWTQHDEQTLFKDMAHPEIFDFEKVLQADIMRLFRHFLGGAYIIPEPIRIVRSVWSINPHFRGSYR
cCCcccccEEEccEEEEEEcHHHHcccccEEcccccHHHHHHHHcccccccEEEEEEccccccccccEEEEEccccccccccccEEEEEcccccccEEEEcccHHHccHHcccHHHHHHHHHHHcccccccccccEEEEcccccccccccccc
****ADGTQYSADRILITVSLGVLKSNLITFVPPLPPKNLNAIKGLAVETSVLYFVLFQGLAFGTIDKIFIRFPKKWWPEDYQGFHFFWTQHDEQTLFKDMAHPEIFDFEKVLQADIMRLFRHFLGGAYIIPEPIRIVRSVWSINPHFRGSYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGSADGTQYSADRILITVSLGVLKSNLITFVPPLPPKNLNAIKGLAVETSVLYFVLFQGLAFGTIDKIFIRFPKKWWPEDYQGFHFFWTQHDEQTLFKDMAHPEIFDFEKVLQADIMRLFRHFLGGAYIIPEPIRIVRSVWSINPHFRGSYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0043170 [BP]macromolecule metabolic processprobableGO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B37, chain A
Confidence level:very confident
Coverage over the Query: 2-45,61-153
View the alignment between query and template
View the model in PyMOL