Diaphorina citri psyllid: psy10809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MLLPMLGIYQEYVRNHHYSLQVLTECKQQPEFVQLLKRLEMKPACQGRSLEMFLTFPMHQIPRYIVTLHELLAHTPHDHVERKSLQNARQQLEDLSRQMHDEVSETENLRKNLAVERLIVEGCDILLDVNQVFVRQ
ccccHHccHHHHHHcHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
MLLPMLGIYQEYVRNHHYSLQVLTECKQQPEFVQLLKRLEMKPACQGRSLEMFLTFPMHQIPRYIVTLHELLAHTPHDHVERKSLQNARQQLEDLSRQMHDEV***ENLRKNLAVERLIVEGCDILLDVNQVFVRQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLPMLGIYQEYVRNHHYSLQVLTECKQQPEFVQLLKRLEMKPACQGRSLEMFLTFPMHQIPRYIVTLHELLAHTPHDHVExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAVERLIVEGCDILLDVNQVFVRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-specific guanine nucleotide-releasing factor 2 Functions as a calcium-regulated nucleotide exchange factor activating both Ras and RAC1 through the exchange of bound GDP for GTP. Preferentially activates HRAS in vivo compared to RRAS based on their different types of prenylation. Functions in synaptic plasticity by contributing to the induction of long term potentiation.confidentP70392
Ras-specific guanine nucleotide-releasing factor 2 Functions as a calcium-regulated nucleotide exchange factor activating both Ras and RAC1 through the exchange of bound GDP for GTP. Preferentially activates HRAS in vivo compared to RRAS based on their different types of prenylation. Functions in synaptic plasticity by contributing to the induction of long term potentiation.confidentQ99JE4
Ras-specific guanine nucleotide-releasing factor 2 Functions as a calcium-regulated nucleotide exchange factor activating both Ras and rac1 through the exchange of bound GDP for GTP. May function in synaptic plasticity.confidentA2CEA7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0046579 [BP]positive regulation of Ras protein signal transductionprobableGO:0051057, GO:0051056, GO:0009966, GO:0009967, GO:0048584, GO:0046578, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035020 [BP]regulation of Rac protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0046578, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032863 [BP]activation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0023051, GO:0046578, GO:0032862, GO:0035023, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0032855, GO:0032856, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005543 [MF]phospholipid bindingprobableGO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005099 [MF]Ras GTPase activator activityprobableGO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0048168 [BP]regulation of neuronal synaptic plasticityprobableGO:0065008, GO:0044057, GO:0031644, GO:0050804, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0035254 [MF]glutamate receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0048011 [BP]neurotrophin TRK receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0038179, GO:0009987, GO:0050794, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0044763
GO:0005089 [MF]Rho guanyl-nucleotide exchange factor activityprobableGO:0005088, GO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JZY, chain A
Confidence level:very confident
Coverage over the Query: 14-19
View the alignment between query and template
View the model in PyMOL