Diaphorina citri psyllid: psy10819


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MVEAEEEYMEQMQVLVSCFLRPFKMAASSKRPPCSHEDVNSIFLNSETVLFLHQIFLKGLTSRMESWPTLVLVDFSIPYSYEQCVNAYLVSEIGLLGDLFDMLLPMLGIYQEYVRNHHYSLQVLTECKQQPEFVQLLKRLEMKPACQGRSLEMFLTFPMHQNAKKNFKKESYF
cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHHcccccccHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccc
MVEAEEEYMEQMQVLVSCFLRPFKM********CSHEDVNSIFLNSETVLFLHQIFLKGLTSRMESWPTLVLVDFSIPYSYEQCVNAYLVSEIGLLGDLFDMLLPMLGIYQEYVRNHHYSLQVLTECKQQPEFVQLLKRLEMKPACQGRSLEMFLTFPMHQNAKKNFKKESYF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEAEEEYMEQMQVLVSCFLRPFKMAASSKRPPCSHEDVNSIFLNSETVLFLHQIFLKGLTSRMESWPTLVLVDFSIPYSYEQCVNAYLVSEIGLLGDLFDMLLPMLGIYQEYVRNHHYSLQVLTECKQQPEFVQLLKRLEMKPACQGRSLEMFLTFPMHQNAKKNFKKESYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-specific guanine nucleotide-releasing factor 1 Promotes the exchange of Ras-bound GDP by GTP.confidentP28818
Ras-specific guanine nucleotide-releasing factor 2 Functions as a calcium-regulated nucleotide exchange factor activating both Ras and rac1 through the exchange of bound GDP for GTP. May function in synaptic plasticity.confidentA2CEA7
Ras-specific guanine nucleotide-releasing factor 2 Functions as a calcium-regulated nucleotide exchange factor activating both Ras and RAC1 through the exchange of bound GDP for GTP. Preferentially activates HRAS in vivo compared to RRAS based on their different types of prenylation. Functions in synaptic plasticity by contributing to the induction of long term potentiation.confidentQ99JE4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0046579 [BP]positive regulation of Ras protein signal transductionprobableGO:0051057, GO:0051056, GO:0009966, GO:0009967, GO:0048584, GO:0046578, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048167 [BP]regulation of synaptic plasticityprobableGO:0065008, GO:0044057, GO:0031644, GO:0050804, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0003674 [MF]molecular_functionprobable
GO:0035020 [BP]regulation of Rac protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0046578, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032863 [BP]activation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0023051, GO:0046578, GO:0032862, GO:0035023, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0032855, GO:0032856, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JV3, chain A
Confidence level:very confident
Coverage over the Query: 1-71,92-172
View the alignment between query and template
View the model in PyMOL