Diaphorina citri psyllid: psy10826

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYDTDTTIESSSDTKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFESKS
cHHHHHccccEEEEEEEccccccccccEEECccccccccEEEEEEEEcccccEEEEEEEcccccccccccEEEEECcccccccccccEEEECcccccccccccccccccccCEccccHHHHHcEEcccccccHHHHHHHccccEEEEcccccccccEEEEEEcccccCEEEECcc
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRS*********************RAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFES**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYDTDTTIESSSDTKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFESKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cathepsin B Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.confidentP07858
Cathepsin B-like cysteine proteinase 3 confidentP43507
Cathepsin B Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.confidentQ5R6D1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004197 [MF]cysteine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CBJ, chain A
Confidence level:very confident
Coverage over the Query: 1-97
View the alignment between query and template
View the model in PyMOL