Psyllid ID: psy10826

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYDTDTTIESSSDTKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFESKS
cHHHHHccccEEEEEEEccccccccccEEEEccccccccEEEEEEEEcccccEEEEEEEcccccccccccEEEEEEcccccccccccEEEEEcccccccccccccccccccEEcccHHHHHHcEEcccccccHHHHHHHccccEEEEcccccccccEEEEEEcccccEEEEEEcc
HHHHHHHHccEEEEEEEEHHHHHEEEEEEccccccEEEEEEEEEEEEEEEccEEEEEEEccEcccccEccEEEEEccccHHHcccccEEEccccccccccccccEEccccccEEccccccEEEEEEcccccHHHHHHHHHHHHHEEEcccccccccEEEEEEccccccEEEEccc
MQLEIFHFGSIVAAIEAHQDLIIYKKGVyqhtvgemsgghAVKIIGWGVEDGVKYWLCVNswgelwgdgglfkirrgtdesrIESFQVsagrvdrdrssdleefeydtdttiesssdTKRAFCRCVLDNTGPCLLYLLRFMNKIILIipttsnlngvvvstvdsepggwwfesks
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRgtdesriesfqvsagrvdrdrssdleefeydtdttiesssdtkRAFCRCVLDNTGPCLLYLLRFMNKIILIIpttsnlngvVVSTVdsepggwwfesks
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYdtdttiesssdtKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFESKS
***EIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRG******************************************RAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWF****
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRS***************************VLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFES**
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYDTDTTIESSSDTKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFESKS
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYDTDTTIESSSDTKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFE***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDESRIESFQVSAGRVDRDRSSDLEEFEYDTDTTIESSSDTKRAFCRCVLDNTGPCLLYLLRFMNKIILIIPTTSNLNGVVVSTVDSEPGGWWFESKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
P43507370 Cathepsin B-like cysteine yes N/A 0.48 0.227 0.571 4e-24
P25792340 Cathepsin B-like cysteine N/A N/A 0.531 0.273 0.5 3e-22
P07858339 Cathepsin B OS=Homo sapie yes N/A 0.548 0.283 0.505 3e-22
Q5R6D1339 Cathepsin B OS=Pongo abel yes N/A 0.548 0.283 0.505 3e-22
Q4R5M2339 Cathepsin B OS=Macaca fas N/A N/A 0.548 0.283 0.505 4e-22
P25807329 Gut-specific cysteine pro no N/A 0.525 0.279 0.526 1e-21
P07688335 Cathepsin B OS=Bos taurus yes N/A 0.514 0.268 0.505 5e-21
P43157342 Cathepsin B-like cysteine N/A N/A 0.485 0.248 0.494 2e-20
A1E295335 Cathepsin B OS=Sus scrofa yes N/A 0.514 0.268 0.494 3e-20
P10605339 Cathepsin B OS=Mus muscul yes N/A 0.548 0.283 0.474 5e-20
>sp|P43507|CPR3_CAEEL Cathepsin B-like cysteine proteinase 3 OS=Caenorhabditis elegans GN=cpr-3 PE=2 SV=1 Back     alignment and function desciption
 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%)

Query: 1   MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
           +Q EI+H+G + A+ + ++D   YK GVY +T G++ GGHAVKIIGWGVE+GV YWL  N
Sbjct: 245 IQTEIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIAN 304

Query: 61  SWGELWGDGGLFKIRRGTDESRIE 84
           SWG  +G+ G FKIRRGT+E +IE
Sbjct: 305 SWGTSFGEKGFFKIRRGTNECQIE 328

Caenorhabditis elegans (taxid: 6239)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine proteinase OS=Schistosoma mansoni PE=2 SV=1 Back     alignment and function description
>sp|P07858|CATB_HUMAN Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3 Back     alignment and function description
>sp|Q5R6D1|CATB_PONAB Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1 Back     alignment and function description
>sp|Q4R5M2|CATB_MACFA Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV=1 Back     alignment and function description
>sp|P25807|CPR1_CAEEL Gut-specific cysteine proteinase OS=Caenorhabditis elegans GN=cpr-1 PE=1 SV=2 Back     alignment and function description
>sp|P07688|CATB_BOVIN Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5 Back     alignment and function description
>sp|P43157|CYSP_SCHJA Cathepsin B-like cysteine proteinase OS=Schistosoma japonicum GN=CATB PE=2 SV=1 Back     alignment and function description
>sp|A1E295|CATB_PIG Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1 Back     alignment and function description
>sp|P10605|CATB_MOUSE Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
7507648 324 hypothetical protein T10H4.12 - Caenorha 0.48 0.259 0.571 2e-22
17559066 370 Protein CPR-3 [Caenorhabditis elegans] g 0.48 0.227 0.571 2e-22
341888694 374 hypothetical protein CAEBREN_31940 [Caen 0.571 0.267 0.509 3e-22
432852559 330 PREDICTED: cathepsin B-like [Oryzias lat 0.514 0.272 0.560 6e-22
170060938 353 cathepsin B [Culex quinquefasciatus] gi| 0.582 0.288 0.504 6e-22
327322926 330 cathepsin B [Oplegnathus fasciatus] 0.514 0.272 0.560 8e-22
45822211 331 cathepsin B-like proteinase [Diabrotica 0.514 0.271 0.566 9e-22
193603738 337 PREDICTED: cathepsin B-like cysteine pro 0.468 0.243 0.548 9e-22
268572255220 Hypothetical protein CBG17829 [Caenorhab 0.542 0.431 0.510 1e-21
268561802 375 C. briggsae CBR-CPR-3 protein [Caenorhab 0.485 0.226 0.564 1e-21
>gi|7507648|pir||T24819 hypothetical protein T10H4.12 - Caenorhabditis elegans Back     alignment and taxonomy information
 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%)

Query: 1   MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
           +Q EI+H+G + A+ + ++D   YK GVY +T G++ GGHAVKIIGWGVE+GV YWL  N
Sbjct: 199 IQTEIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIAN 258

Query: 61  SWGELWGDGGLFKIRRGTDESRIE 84
           SWG  +G+ G FKIRRGT+E +IE
Sbjct: 259 SWGTSFGEKGFFKIRRGTNECQIE 282

Source: Caenorhabditis elegans

Species: Caenorhabditis elegans

Genus: Caenorhabditis

Family: Rhabditidae

Order: Rhabditida

Class: Chromadorea

Phylum: Nematoda

Superkingdom: Eukaryota
>gi|17559066|ref|NP_506790.1| Protein CPR-3 [Caenorhabditis elegans] gi|1169083|sp|P43507.1|CPR3_CAEEL RecName: Full=Cathepsin B-like cysteine proteinase 3; AltName: Full=Cysteine protease-related 3; Flags: Precursor gi|675494|gb|AAA98788.1| cathepsin B-like cysteine proteinase [Caenorhabditis elegans] gi|675496|gb|AAA98782.1| cathepsin B-like cysteine proteinase [Caenorhabditis elegans] gi|14530554|emb|CAB61032.2| Protein CPR-3 [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|341888694|gb|EGT44629.1| hypothetical protein CAEBREN_31940 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|432852559|ref|XP_004067308.1| PREDICTED: cathepsin B-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|170060938|ref|XP_001866023.1| cathepsin B [Culex quinquefasciatus] gi|167879260|gb|EDS42643.1| cathepsin B [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|327322926|gb|AEA48884.1| cathepsin B [Oplegnathus fasciatus] Back     alignment and taxonomy information
>gi|45822211|emb|CAE47502.1| cathepsin B-like proteinase [Diabrotica virgifera virgifera] Back     alignment and taxonomy information
>gi|193603738|ref|XP_001943652.1| PREDICTED: cathepsin B-like cysteine proteinase 5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|268572255|ref|XP_002648916.1| Hypothetical protein CBG17829 [Caenorhabditis briggsae] Back     alignment and taxonomy information
>gi|268561802|ref|XP_002638421.1| C. briggsae CBR-CPR-3 protein [Caenorhabditis briggsae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
WB|WBGene00000783370 cpr-3 [Caenorhabditis elegans 0.514 0.243 0.560 1.2e-24
UNIPROTKB|E2R6Q7339 CTSB "Uncharacterized protein" 0.497 0.256 0.568 5.3e-24
UNIPROTKB|P07858339 CTSB "Cathepsin B" [Homo sapie 0.52 0.268 0.531 1.4e-23
WB|WBGene00000782326 cpr-2 [Caenorhabditis elegans 0.514 0.276 0.516 6.1e-23
WB|WBGene00000781329 cpr-1 [Caenorhabditis elegans 0.52 0.276 0.532 1e-22
ZFIN|ZDB-GENE-040426-2650330 ctsba "cathepsin B, a" [Danio 0.497 0.263 0.534 1.6e-22
UNIPROTKB|F1N9D7340 CTSB "Cathepsin B" [Gallus gal 0.497 0.255 0.522 2.1e-22
UNIPROTKB|P07688335 CTSB "Cathepsin B" [Bos taurus 0.497 0.259 0.522 2.1e-22
UNIPROTKB|A1E295335 CTSB "Cathepsin B" [Sus scrofa 0.497 0.259 0.511 9e-22
MGI|MGI:88561339 Ctsb "cathepsin B" [Mus muscul 0.52 0.268 0.5 1.1e-21
WB|WBGene00000783 cpr-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 51/91 (56%), Positives = 67/91 (73%)

Query:     1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
             +Q EI+H+G + A+ + ++D   YK GVY +T G++ GGHAVKIIGWGVE+GV YWL  N
Sbjct:   245 IQTEIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIAN 304

Query:    61 SWGELWGDGGLFKIRRGTDESRIESFQVSAG 91
             SWG  +G+ G FKIRRGT+E +IE   V AG
Sbjct:   305 SWGTSFGEKGFFKIRRGTNECQIEG-NVVAG 334
GO:0006508 "proteolysis" evidence=IEA
GO:0008234 "cysteine-type peptidase activity" evidence=IEA
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
UNIPROTKB|E2R6Q7 CTSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P07858 CTSB "Cathepsin B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00000782 cpr-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000781 cpr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2650 ctsba "cathepsin B, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9D7 CTSB "Cathepsin B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P07688 CTSB "Cathepsin B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A1E295 CTSB "Cathepsin B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:88561 Ctsb "cathepsin B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P43233CATB_CHICK3, ., 4, ., 2, 2, ., 10.50580.48570.25yesN/A
P07688CATB_BOVIN3, ., 4, ., 2, 2, ., 10.50540.51420.2686yesN/A
Q5R6D1CATB_PONAB3, ., 4, ., 2, 2, ., 10.50510.54850.2831yesN/A
P43507CPR3_CAEEL3, ., 4, ., 2, 2, ., -0.57140.480.2270yesN/A
P07858CATB_HUMAN3, ., 4, ., 2, 2, ., 10.50510.54850.2831yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 4e-44
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 5e-30
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 5e-27
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 2e-21
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 6e-21
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 4e-19
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 2e-15
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 9e-15
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 1e-10
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 9e-10
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 1e-09
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 7e-09
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 8e-09
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 2e-04
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information 
 Score =  145 bits (368), Expect = 4e-44
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 1/91 (1%)

Query: 1   MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
           +  EI   G + AA   ++D + YK GVYQHT G+  GGHAVKIIGWGVE+GV YWL  N
Sbjct: 147 IMKEIMTNGPVQAAFTVYEDFLYYKSGVYQHTSGKQLGGHAVKIIGWGVENGVPYWLAAN 206

Query: 61  SWGELWGDGGLFKIRRGTDESRIESFQVSAG 91
           SWG  WG+ G F+I RG++E  IES +V AG
Sbjct: 207 SWGTDWGENGYFRILRGSNECGIES-EVVAG 236

Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane antibody-mediated interstitial nephritis. It plays a role in renal tubulogenesis and is defective in hereditary tubulointerstitial disorders. TIN-Ag is exclusively expressed in kidney tissues. . Length = 236
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 99.97
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 99.96
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 99.96
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 99.96
PTZ00203348 cathepsin L protease; Provisional 99.95
KOG1543|consensus325 99.95
PF00112219 Peptidase_C1: Papain family cysteine protease This 99.94
PTZ00021489 falcipain-2; Provisional 99.93
PTZ00049693 cathepsin C-like protein; Provisional 99.93
PTZ00200448 cysteine proteinase; Provisional 99.93
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 99.93
KOG1542|consensus372 99.92
KOG1544|consensus470 99.88
PTZ00462 1004 Serine-repeat antigen protein; Provisional 99.88
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 99.87
smart00645174 Pept_C1 Papain family cysteine protease. 99.87
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.61
COG4870372 Cysteine protease [Posttranslational modification, 99.5
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 98.76
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 96.69
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 94.74
PF1432683 DUF4384: Domain of unknown function (DUF4384) 92.1
PF14399317 Transpep_BrtH: NlpC/p60-like transpeptidase 85.09
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 83.87
PF09778212 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP 80.07
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information 
Probab=99.97  E-value=2.4e-30  Score=215.26  Aligned_cols=92  Identities=37%  Similarity=0.697  Sum_probs=84.2

Q ss_pred             CHHHHHcCCceEEEEEeccccccCCCcEEecCCCCCcCCceEEEEEeeecC-CeeEEEEEcCCCCCCCCCcEEEEEeCC-
Q psy10826          1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVED-GVKYWLCVNSWGELWGDGGLFKIRRGT-   78 (175)
Q Consensus         1 Ik~~l~~~GPV~v~i~~~~~f~~y~~Giy~~~~~~~~~~HaV~iVGyg~~~-g~~yWivkNSWG~~WG~~Gy~~i~~~~-   78 (175)
                      ||++|+++|||+++|.+.++|+.|++|||+..++...++|||+|||||+++ +++|||||||||++||++|||||+|+. 
T Consensus       141 i~~~l~~~GPV~v~i~~~~~f~~Y~~GIy~~~~~~~~~~HaV~IVGyG~~~~g~~YWiikNSWG~~WGe~Gy~~i~rg~~  220 (239)
T cd02698         141 MMAEIYARGPISCGIMATEALENYTGGVYKEYVQDPLINHIISVAGWGVDENGVEYWIVRNSWGEPWGERGWFRIVTSSY  220 (239)
T ss_pred             HHHHHHHcCCEEEEEEecccccccCCeEEccCCCCCcCCeEEEEEEEEecCCCCEEEEEEcCCCcccCcCceEEEEccCC
Confidence            688999999999999998899999999998876666789999999999876 999999999999999999999999999 


Q ss_pred             ----CceeeeeeeeeeEEe
Q psy10826         79 ----DESRIESFQVSAGRV   93 (175)
Q Consensus        79 ----n~cgi~~~~~~~~~p   93 (175)
                          |+|+||+. ++.+.|
T Consensus       221 ~~~~~~~~i~~~-~~~~~~  238 (239)
T cd02698         221 KGARYNLAIEED-CAWADP  238 (239)
T ss_pred             cccccccccccc-eEEEee
Confidence                99999999 555555

It can also act as a carboxydipeptidase, like cathepsin B, but has been shown to preferentially cleave substrates through a monopeptidyl carboxypeptidase pathway. The propeptide region of cathepsin X, the shortest among papain-like peptidases, is covalently attached to the active site cysteine in the inactive form of the enzyme. Little is known about the biological function of cathepsin X. Some studies point to a role in early tumorigenesis. A more recent study indicates that cathepsin X expression is restricted to immune cells suggesting a role in phagocytosis and the regulation of the immune response.
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>KOG1542|consensus Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information
>PF14326 DUF4384: Domain of unknown function (DUF4384) Back     alignment and domain information
>PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 3e-23
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 5e-23
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 6e-23
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 7e-23
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 9e-23
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 9e-23
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 9e-23
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 5e-22
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 1e-21
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 1e-21
1mir_A322 Rat Procathepsin B Length = 322 3e-20
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 3e-20
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-20
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 3e-18
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 9e-18
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 9e-18
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 1e-17
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 3e-16
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 2e-10
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 2e-10
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 3e-10
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 3e-10
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 4e-09
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 1e-08
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 1e-08
3hwn_A258 Cathepsin L With Az13010160 Length = 258 4e-08
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 5e-08
3of8_A221 Structural Basis For Reversible And Irreversible In 6e-08
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 6e-08
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 6e-08
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 6e-08
3h89_A220 A Combined Crystallographic And Molecular Dynamics 6e-08
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 7e-08
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 9e-08
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 2e-07
2vhs_A217 Cathsilicatein, A Chimera Length = 217 2e-07
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 3e-07
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 3e-07
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-07
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-07
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 5e-07
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 6e-07
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 6e-07
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 6e-07
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 6e-07
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 6e-07
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 7e-07
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 1e-06
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 2e-06
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 2e-06
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-06
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 2e-06
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 2e-06
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 2e-06
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 3e-06
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 3e-06
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 3e-06
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 3e-06
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 3e-06
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 3e-06
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 3e-06
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 3e-06
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 3e-06
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 3e-06
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 3e-06
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 4e-06
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 4e-06
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 7e-06
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 1e-05
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 1e-05
2act_A220 Crystallographic Refinement Of The Structure Of Act 1e-05
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 3e-05
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 4e-05
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 4e-05
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 4e-05
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 4e-05
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 4e-05
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 5e-05
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 5e-05
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 1e-04
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 1e-04
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 1e-04
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 1e-04
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 1e-04
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 1e-04
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 1e-04
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 2e-04
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 2e-04
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 2e-04
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 2e-04
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 3e-04
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 3e-04
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 4e-04
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
Query: 1   MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
           +Q EI  +G + A    ++D + YK G+Y+H  GE  GGHA++IIGWGVE+   YWL  N
Sbjct: 162 IQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIAN 221
Query: 61  SWGELWGDGGLFKIRRGTDESRIESFQVSAGRVD 94
           SW E WG+ G F+I RG DE  IES +V+AGR++
Sbjct: 222 SWNEDWGENGYFRIVRGRDECSIES-EVTAGRIN 254
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 5e-47
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 7e-46
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 8e-46
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 2e-45
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 1e-39
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 1e-35
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 5e-21
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 3e-18
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-17
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 2e-17
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 3e-17
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 1e-16
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 3e-16
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 3e-16
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 5e-16
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 1e-15
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 1e-15
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 4e-15
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 4e-15
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 4e-15
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 4e-15
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 5e-15
1cqd_A221 Protein (protease II); cysteine protease, glycopro 5e-15
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 5e-15
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 8e-15
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 8e-15
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 1e-14
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 6e-14
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 7e-14
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 1e-13
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 3e-13
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 5e-13
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 8e-13
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 2e-12
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 7e-12
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 8e-12
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 2e-11
3u8e_A222 Papain-like cysteine protease; papain-like cystein 6e-11
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 2e-09
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 5e-05
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
 Score =  152 bits (387), Expect = 5e-47
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 1   MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
           +Q EI  +G + A    ++D + YK G+Y+H  GE  GGHA++IIGWGVE+   YWL  N
Sbjct: 162 IQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIAN 221

Query: 61  SWGELWGDGGLFKIRRGTDESRIESFQVSAGRVD 94
           SW E WG+ G F+I RG DE  IES +V+AGR++
Sbjct: 222 SWNEDWGENGYFRIVRGRDECSIES-EVTAGRIN 254
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 99.97
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 99.97
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 99.97
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 99.97
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 99.97
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 99.97
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 99.97
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 99.97
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 99.97
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 99.97
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 99.97
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 99.96
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 99.96
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 99.96
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 99.96
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 99.96
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 99.96
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 99.96
1cqd_A221 Protein (protease II); cysteine protease, glycopro 99.96
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 99.96
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 99.96
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 99.96
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 99.96
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 99.96
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 99.96
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 99.96
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 99.96
3u8e_A222 Papain-like cysteine protease; papain-like cystein 99.96
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 99.96
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 99.96
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 99.95
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 99.95
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 99.95
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 99.95
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 99.95
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 99.95
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 99.95
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 99.94
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 99.93
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 99.89
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 99.78
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 99.76
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.49
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 86.8
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 86.61
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 84.06
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
Probab=99.97  E-value=6.3e-33  Score=239.68  Aligned_cols=96  Identities=43%  Similarity=0.806  Sum_probs=88.7

Q ss_pred             CHHHHHcCCceEEEEEeccccccCCCcEEecCCCCCcCCceEEEEEeeecCCeeEEEEEcCCCCCCCCCcEEEEEeCCCc
Q psy10826          1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDE   80 (175)
Q Consensus         1 Ik~~l~~~GPV~v~i~~~~~f~~y~~Giy~~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WG~~Gy~~i~~~~n~   80 (175)
                      ||++|+++|||+++|+++++|+.|++|||.++++...++|||+|||||+++|++|||||||||++||++|||||+|+.|+
T Consensus       221 i~~~i~~~GPV~v~i~~~~~f~~Y~~GVy~~~~~~~~~~HaV~iVGyG~~~g~~YWivkNSWG~~WGe~GY~~i~rg~n~  300 (325)
T 3hhi_A          221 YMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKIANSWNTEWGMDGYFLIRRGSSE  300 (325)
T ss_dssp             HHHHHHHHCCEEEEEEEEHHHHTCCSSEECCCSCCEEEEEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSCG
T ss_pred             HHHHHHHCCCEEEEEEeccccccccCceecCCCCCCCCCEEEEEEEEEecCCceEEEEEeCCCCCcccCCEEEEEcCCCe
Confidence            68999999999999999989999999999988776677999999999999999999999999999999999999999999


Q ss_pred             eeeeeeeeeeEEeecCC
Q psy10826         81 SRIESFQVSAGRVDRDR   97 (175)
Q Consensus        81 cgi~~~~~~~~~p~~~~   97 (175)
                      |||++. +++++|.+++
T Consensus       301 CGI~~~-~~~g~p~~~~  316 (325)
T 3hhi_A          301 CGIEDG-GSAGIPLAPN  316 (325)
T ss_dssp             GGTTSC-EEEEEEC---
T ss_pred             ecCccc-eEEeecCCCC
Confidence            999999 9999998754
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 7e-25
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 3e-21
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 2e-20
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 7e-20
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 2e-18
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 4e-18
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 5e-18
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 9e-18
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 6e-17
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 3e-16
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 6e-16
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 6e-16
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 1e-15
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 2e-15
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 6e-15
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 2e-14
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 6e-14
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 1e-12
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 2e-12
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 5e-11
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 0.003
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin B
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 94.6 bits (234), Expect = 7e-25
 Identities = 46/90 (51%), Positives = 57/90 (63%)

Query: 1   MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
           +  EI+  G +  A   + D ++YK GVYQH  GEM GGHA++I+GWGVE+G  YWL  N
Sbjct: 161 IMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVAN 220

Query: 61  SWGELWGDGGLFKIRRGTDESRIESFQVSA 90
           SW   WGD G FKI RG D   IES  V+ 
Sbjct: 221 SWNTDWGDNGFFKILRGQDHCGIESEVVAG 250
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 99.97
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 99.96
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 99.96
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 99.96
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 99.96
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 99.95
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 99.95
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 99.94
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 99.94
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 99.94
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 99.94
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 99.93
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 99.93
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 99.93
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 99.92
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 99.92
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 99.91
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 99.91
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 99.91
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 98.97
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 98.64
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.8e-31  Score=216.75  Aligned_cols=93  Identities=52%  Similarity=0.996  Sum_probs=87.2

Q ss_pred             CHHHHHcCCceEEEEEeccccccCCCcEEecCCCCCcCCceEEEEEeeecCCeeEEEEEcCCCCCCCCCcEEEEEeCCCc
Q psy10826          1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDE   80 (175)
Q Consensus         1 Ik~~l~~~GPV~v~i~~~~~f~~y~~Giy~~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WG~~Gy~~i~~~~n~   80 (175)
                      ||++|+++|||+++|.+.++|+.|++|++..++....++|||+|||||++++++|||||||||++||++|||||+|+.|.
T Consensus       161 ik~~l~~~gpv~~~~~~~~~f~~y~~gi~~~~~~~~~~~Hav~IVGyg~~~g~~ywIvkNSWG~~WGd~GYf~i~~~~n~  240 (254)
T d1gmya_         161 IMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDH  240 (254)
T ss_dssp             HHHHHHHHCCEEEEEEEEGGGTTCCSSEECCCSCCEEEEEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSCG
T ss_pred             HHHHHHHcCCEEEEEEeechhhhccCCccccccccccccEEEEEEEEeccCCceEEEEEcCCCCCcCCCceEEEEcCCCc
Confidence            58899999999999999999999999999888777788999999999999999999999999999999999999999999


Q ss_pred             eeeeeeeeeeEEee
Q psy10826         81 SRIESFQVSAGRVD   94 (175)
Q Consensus        81 cgi~~~~~~~~~p~   94 (175)
                      |||+++ +++++|.
T Consensus       241 cgi~~~-~~~~~p~  253 (254)
T d1gmya_         241 CGIESE-VVAGIPR  253 (254)
T ss_dssp             GGTTTS-CEECCBC
T ss_pred             cCcCCc-eEeccCC
Confidence            999999 7776764
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure