Psyllid ID: psy10826
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| 7507648 | 324 | hypothetical protein T10H4.12 - Caenorha | 0.48 | 0.259 | 0.571 | 2e-22 | |
| 17559066 | 370 | Protein CPR-3 [Caenorhabditis elegans] g | 0.48 | 0.227 | 0.571 | 2e-22 | |
| 341888694 | 374 | hypothetical protein CAEBREN_31940 [Caen | 0.571 | 0.267 | 0.509 | 3e-22 | |
| 432852559 | 330 | PREDICTED: cathepsin B-like [Oryzias lat | 0.514 | 0.272 | 0.560 | 6e-22 | |
| 170060938 | 353 | cathepsin B [Culex quinquefasciatus] gi| | 0.582 | 0.288 | 0.504 | 6e-22 | |
| 327322926 | 330 | cathepsin B [Oplegnathus fasciatus] | 0.514 | 0.272 | 0.560 | 8e-22 | |
| 45822211 | 331 | cathepsin B-like proteinase [Diabrotica | 0.514 | 0.271 | 0.566 | 9e-22 | |
| 193603738 | 337 | PREDICTED: cathepsin B-like cysteine pro | 0.468 | 0.243 | 0.548 | 9e-22 | |
| 268572255 | 220 | Hypothetical protein CBG17829 [Caenorhab | 0.542 | 0.431 | 0.510 | 1e-21 | |
| 268561802 | 375 | C. briggsae CBR-CPR-3 protein [Caenorhab | 0.485 | 0.226 | 0.564 | 1e-21 |
| >gi|7507648|pir||T24819 hypothetical protein T10H4.12 - Caenorhabditis elegans | Back alignment and taxonomy information |
|---|
Score = 110 bits (275), Expect = 2e-22, Method: Compositional matrix adjust.
Identities = 48/84 (57%), Positives = 64/84 (76%)
Query: 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
+Q EI+H+G + A+ + ++D YK GVY +T G++ GGHAVKIIGWGVE+GV YWL N
Sbjct: 199 IQTEIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIAN 258
Query: 61 SWGELWGDGGLFKIRRGTDESRIE 84
SWG +G+ G FKIRRGT+E +IE
Sbjct: 259 SWGTSFGEKGFFKIRRGTNECQIE 282
|
Source: Caenorhabditis elegans Species: Caenorhabditis elegans Genus: Caenorhabditis Family: Rhabditidae Order: Rhabditida Class: Chromadorea Phylum: Nematoda Superkingdom: Eukaryota |
| >gi|17559066|ref|NP_506790.1| Protein CPR-3 [Caenorhabditis elegans] gi|1169083|sp|P43507.1|CPR3_CAEEL RecName: Full=Cathepsin B-like cysteine proteinase 3; AltName: Full=Cysteine protease-related 3; Flags: Precursor gi|675494|gb|AAA98788.1| cathepsin B-like cysteine proteinase [Caenorhabditis elegans] gi|675496|gb|AAA98782.1| cathepsin B-like cysteine proteinase [Caenorhabditis elegans] gi|14530554|emb|CAB61032.2| Protein CPR-3 [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|341888694|gb|EGT44629.1| hypothetical protein CAEBREN_31940 [Caenorhabditis brenneri] | Back alignment and taxonomy information |
|---|
| >gi|432852559|ref|XP_004067308.1| PREDICTED: cathepsin B-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|170060938|ref|XP_001866023.1| cathepsin B [Culex quinquefasciatus] gi|167879260|gb|EDS42643.1| cathepsin B [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|327322926|gb|AEA48884.1| cathepsin B [Oplegnathus fasciatus] | Back alignment and taxonomy information |
|---|
| >gi|45822211|emb|CAE47502.1| cathepsin B-like proteinase [Diabrotica virgifera virgifera] | Back alignment and taxonomy information |
|---|
| >gi|193603738|ref|XP_001943652.1| PREDICTED: cathepsin B-like cysteine proteinase 5-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|268572255|ref|XP_002648916.1| Hypothetical protein CBG17829 [Caenorhabditis briggsae] | Back alignment and taxonomy information |
|---|
| >gi|268561802|ref|XP_002638421.1| C. briggsae CBR-CPR-3 protein [Caenorhabditis briggsae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| WB|WBGene00000783 | 370 | cpr-3 [Caenorhabditis elegans | 0.514 | 0.243 | 0.560 | 1.2e-24 | |
| UNIPROTKB|E2R6Q7 | 339 | CTSB "Uncharacterized protein" | 0.497 | 0.256 | 0.568 | 5.3e-24 | |
| UNIPROTKB|P07858 | 339 | CTSB "Cathepsin B" [Homo sapie | 0.52 | 0.268 | 0.531 | 1.4e-23 | |
| WB|WBGene00000782 | 326 | cpr-2 [Caenorhabditis elegans | 0.514 | 0.276 | 0.516 | 6.1e-23 | |
| WB|WBGene00000781 | 329 | cpr-1 [Caenorhabditis elegans | 0.52 | 0.276 | 0.532 | 1e-22 | |
| ZFIN|ZDB-GENE-040426-2650 | 330 | ctsba "cathepsin B, a" [Danio | 0.497 | 0.263 | 0.534 | 1.6e-22 | |
| UNIPROTKB|F1N9D7 | 340 | CTSB "Cathepsin B" [Gallus gal | 0.497 | 0.255 | 0.522 | 2.1e-22 | |
| UNIPROTKB|P07688 | 335 | CTSB "Cathepsin B" [Bos taurus | 0.497 | 0.259 | 0.522 | 2.1e-22 | |
| UNIPROTKB|A1E295 | 335 | CTSB "Cathepsin B" [Sus scrofa | 0.497 | 0.259 | 0.511 | 9e-22 | |
| MGI|MGI:88561 | 339 | Ctsb "cathepsin B" [Mus muscul | 0.52 | 0.268 | 0.5 | 1.1e-21 |
| WB|WBGene00000783 cpr-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
Identities = 51/91 (56%), Positives = 67/91 (73%)
Query: 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
+Q EI+H+G + A+ + ++D YK GVY +T G++ GGHAVKIIGWGVE+GV YWL N
Sbjct: 245 IQTEIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIAN 304
Query: 61 SWGELWGDGGLFKIRRGTDESRIESFQVSAG 91
SWG +G+ G FKIRRGT+E +IE V AG
Sbjct: 305 SWGTSFGEKGFFKIRRGTNECQIEG-NVVAG 334
|
|
| UNIPROTKB|E2R6Q7 CTSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07858 CTSB "Cathepsin B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000782 cpr-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000781 cpr-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2650 ctsba "cathepsin B, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9D7 CTSB "Cathepsin B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07688 CTSB "Cathepsin B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1E295 CTSB "Cathepsin B" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88561 Ctsb "cathepsin B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 4e-44 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 5e-30 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 5e-27 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-21 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 6e-21 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 4e-19 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 2e-15 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 9e-15 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 1e-10 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 9e-10 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 1e-09 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 7e-09 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 8e-09 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 2e-04 |
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
Score = 145 bits (368), Expect = 4e-44
Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
Query: 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
+ EI G + AA ++D + YK GVYQHT G+ GGHAVKIIGWGVE+GV YWL N
Sbjct: 147 IMKEIMTNGPVQAAFTVYEDFLYYKSGVYQHTSGKQLGGHAVKIIGWGVENGVPYWLAAN 206
Query: 61 SWGELWGDGGLFKIRRGTDESRIESFQVSAG 91
SWG WG+ G F+I RG++E IES +V AG
Sbjct: 207 SWGTDWGENGYFRILRGSNECGIES-EVVAG 236
|
Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane antibody-mediated interstitial nephritis. It plays a role in renal tubulogenesis and is defective in hereditary tubulointerstitial disorders. TIN-Ag is exclusively expressed in kidney tissues. . Length = 236 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 99.97 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 99.96 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 99.96 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 99.96 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 99.95 | |
| KOG1543|consensus | 325 | 99.95 | ||
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 99.94 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 99.93 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 99.93 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 99.93 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 99.93 | |
| KOG1542|consensus | 372 | 99.92 | ||
| KOG1544|consensus | 470 | 99.88 | ||
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.88 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.87 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.87 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.61 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.5 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.76 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 96.69 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 94.74 | |
| PF14326 | 83 | DUF4384: Domain of unknown function (DUF4384) | 92.1 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 85.09 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 83.87 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 80.07 |
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.4e-30 Score=215.26 Aligned_cols=92 Identities=37% Similarity=0.697 Sum_probs=84.2
Q ss_pred CHHHHHcCCceEEEEEeccccccCCCcEEecCCCCCcCCceEEEEEeeecC-CeeEEEEEcCCCCCCCCCcEEEEEeCC-
Q psy10826 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVED-GVKYWLCVNSWGELWGDGGLFKIRRGT- 78 (175)
Q Consensus 1 Ik~~l~~~GPV~v~i~~~~~f~~y~~Giy~~~~~~~~~~HaV~iVGyg~~~-g~~yWivkNSWG~~WG~~Gy~~i~~~~- 78 (175)
||++|+++|||+++|.+.++|+.|++|||+..++...++|||+|||||+++ +++|||||||||++||++|||||+|+.
T Consensus 141 i~~~l~~~GPV~v~i~~~~~f~~Y~~GIy~~~~~~~~~~HaV~IVGyG~~~~g~~YWiikNSWG~~WGe~Gy~~i~rg~~ 220 (239)
T cd02698 141 MMAEIYARGPISCGIMATEALENYTGGVYKEYVQDPLINHIISVAGWGVDENGVEYWIVRNSWGEPWGERGWFRIVTSSY 220 (239)
T ss_pred HHHHHHHcCCEEEEEEecccccccCCeEEccCCCCCcCCeEEEEEEEEecCCCCEEEEEEcCCCcccCcCceEEEEccCC
Confidence 688999999999999998899999999998876666789999999999876 999999999999999999999999999
Q ss_pred ----CceeeeeeeeeeEEe
Q psy10826 79 ----DESRIESFQVSAGRV 93 (175)
Q Consensus 79 ----n~cgi~~~~~~~~~p 93 (175)
|+|+||+. ++.+.|
T Consensus 221 ~~~~~~~~i~~~-~~~~~~ 238 (239)
T cd02698 221 KGARYNLAIEED-CAWADP 238 (239)
T ss_pred cccccccccccc-eEEEee
Confidence 99999999 555555
|
It can also act as a carboxydipeptidase, like cathepsin B, but has been shown to preferentially cleave substrates through a monopeptidyl carboxypeptidase pathway. The propeptide region of cathepsin X, the shortest among papain-like peptidases, is covalently attached to the active site cysteine in the inactive form of the enzyme. Little is known about the biological function of cathepsin X. Some studies point to a role in early tumorigenesis. A more recent study indicates that cathepsin X expression is restricted to immune cells suggesting a role in phagocytosis and the regulation of the immune response. |
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >KOG1542|consensus | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF14326 DUF4384: Domain of unknown function (DUF4384) | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 175 | ||||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 3e-23 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 5e-23 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 6e-23 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 7e-23 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 9e-23 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 9e-23 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 9e-23 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 5e-22 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 1e-21 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 1e-21 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 3e-20 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 3e-20 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-20 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 3e-18 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 9e-18 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 9e-18 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 1e-17 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 3e-16 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 2e-10 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 2e-10 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 3e-10 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 3e-10 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 4e-09 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 1e-08 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 1e-08 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 4e-08 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 5e-08 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 6e-08 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 6e-08 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 6e-08 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 6e-08 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 6e-08 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 7e-08 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 9e-08 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 2e-07 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 2e-07 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 3e-07 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 3e-07 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 4e-07 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 4e-07 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 5e-07 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 6e-07 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 6e-07 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 6e-07 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 6e-07 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 6e-07 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 7e-07 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 1e-06 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 2e-06 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 2e-06 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-06 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 2e-06 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 2e-06 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 2e-06 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 3e-06 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 3e-06 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 3e-06 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 3e-06 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 3e-06 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 3e-06 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 3e-06 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 3e-06 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 3e-06 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 3e-06 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 3e-06 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 4e-06 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 4e-06 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 7e-06 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 1e-05 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 1e-05 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-05 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 3e-05 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 4e-05 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 4e-05 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 4e-05 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 4e-05 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 4e-05 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 5e-05 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 5e-05 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 1e-04 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 1e-04 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 1e-04 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 1e-04 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 1e-04 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 1e-04 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 1e-04 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 2e-04 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 2e-04 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 2e-04 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 2e-04 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 3e-04 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 3e-04 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 4e-04 |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
|
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 5e-47 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 7e-46 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 8e-46 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 2e-45 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 1e-39 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 1e-35 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 5e-21 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 3e-18 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-17 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 2e-17 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 3e-17 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 1e-16 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 3e-16 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 3e-16 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 5e-16 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 1e-15 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 1e-15 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 4e-15 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 4e-15 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 4e-15 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 4e-15 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 5e-15 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 5e-15 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 5e-15 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 8e-15 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 8e-15 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 1e-14 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 6e-14 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 7e-14 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 1e-13 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 3e-13 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 5e-13 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 8e-13 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 2e-12 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 7e-12 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 8e-12 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 2e-11 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 6e-11 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 2e-09 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 5e-05 |
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
Score = 152 bits (387), Expect = 5e-47
Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
Query: 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
+Q EI +G + A ++D + YK G+Y+H GE GGHA++IIGWGVE+ YWL N
Sbjct: 162 IQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIAN 221
Query: 61 SWGELWGDGGLFKIRRGTDESRIESFQVSAGRVD 94
SW E WG+ G F+I RG DE IES +V+AGR++
Sbjct: 222 SWNEDWGENGYFRIVRGRDECSIES-EVTAGRIN 254
|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 99.97 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 99.97 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 99.97 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 99.97 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 99.97 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 99.97 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 99.97 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 99.97 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 99.97 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 99.97 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 99.97 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 99.96 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 99.96 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 99.96 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 99.96 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 99.96 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 99.96 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 99.96 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 99.96 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 99.96 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 99.96 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 99.96 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 99.96 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 99.96 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 99.96 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 99.96 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 99.96 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 99.96 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 99.96 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 99.96 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 99.95 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 99.95 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 99.95 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 99.95 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 99.95 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 99.95 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 99.95 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 99.94 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 99.93 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.89 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.78 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.76 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.49 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 86.8 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 86.61 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 84.06 |
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=6.3e-33 Score=239.68 Aligned_cols=96 Identities=43% Similarity=0.806 Sum_probs=88.7
Q ss_pred CHHHHHcCCceEEEEEeccccccCCCcEEecCCCCCcCCceEEEEEeeecCCeeEEEEEcCCCCCCCCCcEEEEEeCCCc
Q psy10826 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDE 80 (175)
Q Consensus 1 Ik~~l~~~GPV~v~i~~~~~f~~y~~Giy~~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WG~~Gy~~i~~~~n~ 80 (175)
||++|+++|||+++|+++++|+.|++|||.++++...++|||+|||||+++|++|||||||||++||++|||||+|+.|+
T Consensus 221 i~~~i~~~GPV~v~i~~~~~f~~Y~~GVy~~~~~~~~~~HaV~iVGyG~~~g~~YWivkNSWG~~WGe~GY~~i~rg~n~ 300 (325)
T 3hhi_A 221 YMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKIANSWNTEWGMDGYFLIRRGSSE 300 (325)
T ss_dssp HHHHHHHHCCEEEEEEEEHHHHTCCSSEECCCSCCEEEEEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSCG
T ss_pred HHHHHHHCCCEEEEEEeccccccccCceecCCCCCCCCCEEEEEEEEEecCCceEEEEEeCCCCCcccCCEEEEEcCCCe
Confidence 68999999999999999989999999999988776677999999999999999999999999999999999999999999
Q ss_pred eeeeeeeeeeEEeecCC
Q psy10826 81 SRIESFQVSAGRVDRDR 97 (175)
Q Consensus 81 cgi~~~~~~~~~p~~~~ 97 (175)
|||++. +++++|.+++
T Consensus 301 CGI~~~-~~~g~p~~~~ 316 (325)
T 3hhi_A 301 CGIEDG-GSAGIPLAPN 316 (325)
T ss_dssp GGTTSC-EEEEEEC---
T ss_pred ecCccc-eEEeecCCCC
Confidence 999999 9999998754
|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 175 | ||||
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 7e-25 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 3e-21 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 2e-20 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 7e-20 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 2e-18 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 4e-18 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 5e-18 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 9e-18 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 6e-17 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 3e-16 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 6e-16 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 6e-16 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-15 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 2e-15 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 6e-15 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 2e-14 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 6e-14 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 1e-12 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-12 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 5e-11 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 0.003 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Score = 94.6 bits (234), Expect = 7e-25
Identities = 46/90 (51%), Positives = 57/90 (63%)
Query: 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVN 60
+ EI+ G + A + D ++YK GVYQH GEM GGHA++I+GWGVE+G YWL N
Sbjct: 161 IMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVAN 220
Query: 61 SWGELWGDGGLFKIRRGTDESRIESFQVSA 90
SW WGD G FKI RG D IES V+
Sbjct: 221 SWNTDWGDNGFFKILRGQDHCGIESEVVAG 250
|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.97 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 99.96 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.96 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 99.96 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 99.96 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.95 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 99.95 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 99.94 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 99.94 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.94 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 99.94 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.93 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.93 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 99.93 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 99.92 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 99.92 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.91 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.91 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.91 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.97 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.64 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=1.8e-31 Score=216.75 Aligned_cols=93 Identities=52% Similarity=0.996 Sum_probs=87.2
Q ss_pred CHHHHHcCCceEEEEEeccccccCCCcEEecCCCCCcCCceEEEEEeeecCCeeEEEEEcCCCCCCCCCcEEEEEeCCCc
Q psy10826 1 MQLEIFHFGSIVAAIEAHQDLIIYKKGVYQHTVGEMSGGHAVKIIGWGVEDGVKYWLCVNSWGELWGDGGLFKIRRGTDE 80 (175)
Q Consensus 1 Ik~~l~~~GPV~v~i~~~~~f~~y~~Giy~~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WG~~Gy~~i~~~~n~ 80 (175)
||++|+++|||+++|.+.++|+.|++|++..++....++|||+|||||++++++|||||||||++||++|||||+|+.|.
T Consensus 161 ik~~l~~~gpv~~~~~~~~~f~~y~~gi~~~~~~~~~~~Hav~IVGyg~~~g~~ywIvkNSWG~~WGd~GYf~i~~~~n~ 240 (254)
T d1gmya_ 161 IMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDH 240 (254)
T ss_dssp HHHHHHHHCCEEEEEEEEGGGTTCCSSEECCCSCCEEEEEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSCG
T ss_pred HHHHHHHcCCEEEEEEeechhhhccCCccccccccccccEEEEEEEEeccCCceEEEEEcCCCCCcCCCceEEEEcCCCc
Confidence 58899999999999999999999999999888777788999999999999999999999999999999999999999999
Q ss_pred eeeeeeeeeeEEee
Q psy10826 81 SRIESFQVSAGRVD 94 (175)
Q Consensus 81 cgi~~~~~~~~~p~ 94 (175)
|||+++ +++++|.
T Consensus 241 cgi~~~-~~~~~p~ 253 (254)
T d1gmya_ 241 CGIESE-VVAGIPR 253 (254)
T ss_dssp GGTTTS-CEECCBC
T ss_pred cCcCCc-eEeccCC
Confidence 999999 7776764
|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|