Diaphorina citri psyllid: psy10828

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----

MSDLVKYSRVGKFSADAERNTSKTVTLGGTRTGPDEPPAGPGAVSKARGPQFGLIELEIFSAAGEIFQKKKAIISSVSPQKRGAPKSAGPVAVCHSALWWAKEISFPQAGLVCKLNTRCSIIAACNPKGHYDPNIPISVNIAIASPLLSRFDLVLVLLDSKSEQWDKMVSNYILFGKRLGPSSNQATSLWDVEKLQAYFYLIKGLRPQMTLEANRILTRYYQAQRKADMRNAARTTVRLLESLIR

cccccccccccccccccccHHcccccccCCccccccccccccCEEEECcccccccEEEEEEccEEEEEEcccEEEECcccccccccccccHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHccccccccccccHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHcc

****VKYSRVGKF*ADAERNTSKTVTLGGTRTGP************ARGPQFGLIELEIFSAAGEIFQKKKAIISS********PKSAGPVAVCHSALWWAKEISFPQAGLVCKLNTRCSIIAACNPKGHYDPNIPISVNIAIASPLLSRFDLVLVLLDSKSEQWDKMVSNYILFGKRLGPSSNQATSLWDVEKLQAYFYLIKGLRPQMTLEANRILTRYYQAQ************VRLLESLIR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA helicase MCM9		confident	Q9NXL9
DNA helicase MCM9	Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. In eggs, required for MCM2-7 loading onto chromatin during DNA replication. Probably not required for DNA replication in other cells.	confident	F6RIX4
DNA helicase MCM9	Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart.	confident	F1M5F3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0097362 [CC]	MCM8-MCM9 complex	probable	GO:0043234, GO:0005575, GO:0042555, GO:0032991
GO:0000724 [BP]	double-strand break repair via homologous recombination	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0006302, GO:0000725, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0044260, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 18-245
View the alignment between query and template
View the model in PyMOL