Diaphorina citri psyllid: psy10837

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------

MEKKSFEFIGRRDKFQDQSSFVSTAPPLPARTAGGPPSSGDLSLNLSKQSSRTTSAPTSPAKTRESLLQRVQSLTGQARDQGASIIGAMTQTASAARASYNKDRCFSLLVIDDQNTDWSKYFRGRRLHGDYDVRVEQAEFKELSLTANGDLGCVVSMAVFRGGTKVVRSFKPDMILIRQNLRDAGEDHKNLLLGFNIGGIPSINTLQGVYNFQVPKLVLDKPWVFAHLLQLQRKLGKENFPLIDITYYPNFKEMVSKMTAPKYPVVFKIGHAHSGFGKDMAGVVAVANTYCTTEPYIDSKFDVHVQKIGSNYKAFQ

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccEEEEEECcccccHHHHcccccccccEEEEEEEEEEEEEEEEEEccccEEEEEEEEccccEEEEEccccEEEEEccccccccccccEEEEEEEcccccccccccEEcccccccccccHHHHHHHHHHHHHHcccccccccCEcccccHHHccccccccccEEEEEcccccccccHHHHHHHHHccCEEccccccccccEEEEEccccccccc

*****************************************************************************************************KDRCFSLLVIDDQNTDWSKYFRGRRLHGDYDVRVEQAEFKELSLTANGDLGCVVSMAVFRGGTKVVRSFKPDMILIRQNLRDAGEDHKNLLLGFNIGGIPSINTLQGVYNFQVPKLVLDKPWVFAHLLQLQRKLGKENFPLIDITYYPNFKEMVSKMTAPKYPVVFKIGHAHSGFGKDMAGVVAVANTYCTTEPYIDSKFDVHVQKIGS*Y****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Synapsin-1	Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.	confident	P17599
Synapsin-1	Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level.	confident	P17600
Synapsin	Plays a significant role in nervous system function, which is subtle at the cellular level but manifests itself in complex behavior.	confident	Q24546

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0030672 [CC]	synaptic vesicle membrane	probable	GO:0008021, GO:0043229, GO:0045202, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0050877 [BP]	neurological system process	probable	GO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043195 [CC]	terminal bouton	probable	GO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PK8, chain A
Confidence level:very confident
Coverage over the Query: 107-315
View the alignment between query and template
View the model in PyMOL