Diaphorina citri psyllid: psy10841


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MAGNPMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSERAKVECGGIHS
cccccccccccccccccccccccccccccccccccccccccccccCEccccccccccccEEEEEEccEEEEEEEEEcccEEEEccccccccccccEEEEEcEEEccccccccEEEcEEEEEEccccccccccccEEEEEcccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEccccccccccccccccEEEEccccccccccccccccccccccccccccEEEEEEEEccccccccccccEEEcccccHHHHHHHccccccccccccc
***************************************ILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMS**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGNPMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSERAKVECGGIHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine protease nudel Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Nudel, pipe and windbeutel together trigger the protease cascade within the extraembryonic perivitelline compartment which induces dorsoventral polarity of the Drosophila embryo.confidentP98159

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0046658 [CC]anchored to plasma membraneprobableGO:0031226, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224, GO:0031225
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0007276 [BP]gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048609
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0017080 [MF]sodium channel regulator activityprobableGO:0016247, GO:0003674
GO:0019897 [CC]extrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0022617 [BP]extracellular matrix disassemblyprobableGO:0009987, GO:0016043, GO:0008150, GO:0030198, GO:0044763, GO:0071840, GO:0043062, GO:0022411, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0034097 [BP]response to cytokine stimulusprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0006814 [BP]sodium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0006952 [BP]defense responseprobableGO:0006950, GO:0008150, GO:0050896
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0030163 [BP]protein catabolic processprobableGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0030195 [BP]negative regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F9N, chain A
Confidence level:very confident
Coverage over the Query: 46-276
View the alignment between query and template
View the model in PyMOL
Template: 2B9L, chain A
Confidence level:very confident
Coverage over the Query: 33-280
View the alignment between query and template
View the model in PyMOL