Psyllid ID: psy10841


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MAGNPMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSERAKVECGGIHS
cccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccEEEEEEccEEEEEEEEEcccEEEEccccccccccccEEEEEcEEEccccccccEEEcEEEEEEccccccccccccEEEEEcccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEccccccccccccccccEEEEccccccccccccccccccccccccccccEEEEEEEEccccccccccccEEEcccccHHHHHHHccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccEccEEccccccccEEEEEEccEEEEEEEEEEccEEEEccHHHHHcccccEEEEEcccEccccccccEEEEEEEEEEcccccccccccccEEEEEccccccEccEccccEcccccccccccEEEEEEccccccccccccEcEEEEEEEcccccccccccccEEEEcccccccEccccccccEEEEEcccEEEEEEEEEccEcccccEcccccEEEEEHHHcHHHHHHHccHcccccccccc
magnpmgarnmagnpmearnmagnplgarnmatdmagnpilgsgrvvggkkaelgAWPWLIALYRDGffhcggvvldeswVMTAAHCVDGFEKHYFEVYAGMlrrfsfspteqvrpvSRIVMHSMFKRAEMTNDLALLQLAaplrynryvrpiclpdvtetpepystctavgwgavfehgpdpdhmrevqvpilpackhYEDRIADVIcagmpqggrdtcqgdsggpllcpvpgsqgrwYVAGVVshgegcarpnepgvytRVSQFVPwlmsnserakvecggihs
MAGNPMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRfsfspteqvrpVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPwlmsnserakvecggihs
MAGNPMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSERAKVECGGIHS
***************************************ILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMS**************
****************************************LGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRR********VRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLM***************
********RNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSERAKVECGGIHS
****PMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSER**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGNPMGARNMAGNPMEARNMAGNPLGARNMATDMAGNPILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSERAKVECGGIHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
P98159 2616 Serine protease nudel OS= yes N/A 0.828 0.090 0.506 2e-69
P26262638 Plasma kallikrein OS=Mus yes N/A 0.807 0.362 0.389 7e-48
P14272638 Plasma kallikrein OS=Ratt yes N/A 0.814 0.365 0.359 1e-46
P980731019 Enteropeptidase OS=Homo s yes N/A 0.786 0.220 0.389 7e-46
P0CW18 603 Putative serine protease no N/A 0.881 0.417 0.415 8e-46
P03952638 Plasma kallikrein OS=Homo no N/A 0.811 0.363 0.364 3e-45
P980721035 Enteropeptidase OS=Bos ta no N/A 0.793 0.219 0.373 7e-45
P980741034 Enteropeptidase OS=Sus sc no N/A 0.793 0.219 0.373 2e-44
Q2KJ63636 Plasma kallikrein OS=Bos no N/A 0.797 0.358 0.362 8e-44
Q9ES87342 Prostasin OS=Rattus norve no N/A 0.772 0.646 0.370 7e-42
>sp|P98159|NUDEL_DROME Serine protease nudel OS=Drosophila melanogaster GN=ndl PE=1 SV=2 Back     alignment and function desciption
 Score =  262 bits (670), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 125/247 (50%), Positives = 170/247 (68%), Gaps = 10/247 (4%)

Query: 40   ILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVY 99
            I+G GR+VGG       WP+++A+YR+G FHCGG +  + W+++AAHCV  + K+++EV 
Sbjct: 1139 IVGDGRIVGGSYTSALQWPFVVAIYRNGKFHCGGTIYSDRWIISAAHCVINYGKYFYEVR 1198

Query: 100  AGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVT 159
            AG+LRR S+SP  Q++PVS +V+H  ++R  M NDL+LL+L  PL++NR+V+PICLPD  
Sbjct: 1199 AGLLRRSSYSPATQIQPVSHVVVHQAYERRSMRNDLSLLRLLNPLQFNRWVKPICLPDKG 1258

Query: 160  ET---------PEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICA 210
             T         P  ++ CT VGWGA+ E GP  D MR+V VPI   C   ED+ ++ ICA
Sbjct: 1259 RTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPIRKKCTDPEDQASEDICA 1318

Query: 211  GMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWL 270
            G P GGRD CQGDSGGPL C    +   +Y+AGVVSHG GCARP E GVYTRV+ ++ WL
Sbjct: 1319 GDPDGGRDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWL 1378

Query: 271  -MSNSER 276
             M+ + R
Sbjct: 1379 EMATTPR 1385




Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Nudel, pipe and windbeutel together trigger the protease cascade within the extraembryonic perivitelline compartment which induces dorsoventral polarity of the Drosophila embryo.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|P26262|KLKB1_MOUSE Plasma kallikrein OS=Mus musculus GN=Klkb1 PE=1 SV=2 Back     alignment and function description
>sp|P14272|KLKB1_RAT Plasma kallikrein OS=Rattus norvegicus GN=Klkb1 PE=1 SV=1 Back     alignment and function description
>sp|P98073|ENTK_HUMAN Enteropeptidase OS=Homo sapiens GN=TMPRSS15 PE=1 SV=3 Back     alignment and function description
>sp|P0CW18|PRS56_HUMAN Putative serine protease 56 OS=Homo sapiens GN=PRSS56 PE=5 SV=1 Back     alignment and function description
>sp|P03952|KLKB1_HUMAN Plasma kallikrein OS=Homo sapiens GN=KLKB1 PE=1 SV=1 Back     alignment and function description
>sp|P98072|ENTK_BOVIN Enteropeptidase OS=Bos taurus GN=TMPRSS15 PE=1 SV=1 Back     alignment and function description
>sp|P98074|ENTK_PIG Enteropeptidase OS=Sus scrofa GN=TMPRSS15 PE=1 SV=1 Back     alignment and function description
>sp|Q2KJ63|KLKB1_BOVIN Plasma kallikrein OS=Bos taurus GN=KLKB1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ES87|PRSS8_RAT Prostasin OS=Rattus norvegicus GN=Prss8 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
328712270 1775 PREDICTED: hypothetical protein LOC10016 0.807 0.130 0.609 1e-88
270002798 1640 serine protease P19 [Tribolium castaneum 0.940 0.164 0.510 1e-86
383856231 2004 PREDICTED: serine protease nudel-like [M 0.821 0.117 0.587 2e-86
189234398 1454 PREDICTED: similar to ovarian serine pro 0.940 0.185 0.510 2e-85
357625958 1603 ovarian serine protease [Danaus plexippu 0.790 0.140 0.575 8e-85
380015057 1837 PREDICTED: serine protease nudel-like [A 0.828 0.129 0.560 3e-84
112984438 1801 ovarian serine protease [Bombyx mori] gi 0.849 0.134 0.540 7e-84
328778729 1954 PREDICTED: serine protease nudel [Apis m 0.832 0.121 0.555 3e-83
242012000 1605 hypothetical protein Phum_PHUM269170 [Pe 0.828 0.147 0.557 3e-82
307180184 2030 Serine protease nudel [Camponotus florid 0.804 0.113 0.548 2e-79
>gi|328712270|ref|XP_001949959.2| PREDICTED: hypothetical protein LOC100168823 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  332 bits (851), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 142/233 (60%), Positives = 177/233 (75%), Gaps = 2/233 (0%)

Query: 45   RVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLR 104
            RVVGG  +  GAWPWLIALY+DG FHCGGV+L + WV+TAAHCV+ ++KH++EV AG+LR
Sbjct: 897  RVVGGIASNPGAWPWLIALYQDGIFHCGGVILSDQWVLTAAHCVNQYKKHFYEVQAGILR 956

Query: 105  RFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPD--VTETP 162
            RFSFSP EQ R V+  ++H+ + R+ M NDLALL+L   L +NR++RP+CLPD  ++  P
Sbjct: 957  RFSFSPMEQSRIVTHAIIHTQYSRSTMENDLALLRLDRSLEFNRWIRPVCLPDSKLSWIP 1016

Query: 163  EPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICAGMPQGGRDTCQG 222
             P + CTAVGWGA  EHGPDPD+MREV+VPIL  C H  D     ICAG   GG DTCQG
Sbjct: 1017 FPGTMCTAVGWGATVEHGPDPDNMREVEVPILAECTHKSDIDGKEICAGYLSGGHDTCQG 1076

Query: 223  DSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSE 275
            DSGGPLLC  P +  +WYVAG+VSHGEGCARP EPGVYTRV+ ++ W+   +E
Sbjct: 1077 DSGGPLLCREPNNLNKWYVAGIVSHGEGCARPMEPGVYTRVALYMDWIFKATE 1129




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270002798|gb|EEZ99245.1| serine protease P19 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383856231|ref|XP_003703613.1| PREDICTED: serine protease nudel-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|189234398|ref|XP_974954.2| PREDICTED: similar to ovarian serine protease [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357625958|gb|EHJ76225.1| ovarian serine protease [Danaus plexippus] Back     alignment and taxonomy information
>gi|380015057|ref|XP_003691528.1| PREDICTED: serine protease nudel-like [Apis florea] Back     alignment and taxonomy information
>gi|112984438|ref|NP_001037168.1| ovarian serine protease [Bombyx mori] gi|18157552|gb|AAL62027.1|AF294884_1 ovarian serine protease [Bombyx mori] Back     alignment and taxonomy information
>gi|328778729|ref|XP_623911.3| PREDICTED: serine protease nudel [Apis mellifera] Back     alignment and taxonomy information
>gi|242012000|ref|XP_002426731.1| hypothetical protein Phum_PHUM269170 [Pediculus humanus corporis] gi|212510902|gb|EEB13993.1| hypothetical protein Phum_PHUM269170 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307180184|gb|EFN68217.1| Serine protease nudel [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
FB|FBgn0002926 2616 ndl "nudel" [Drosophila melano 0.828 0.090 0.506 5.9e-66
UNIPROTKB|F1Q3Q5 602 PRSS56 "Uncharacterized protei 0.842 0.400 0.438 2.9e-48
MGI|MGI:102849638 Klkb1 "kallikrein B, plasma 1" 0.807 0.362 0.393 6e-48
UNIPROTKB|P0CW18 603 PRSS56 "Putative serine protea 0.881 0.417 0.415 7.7e-48
RGD|67382638 Klkb1 "kallikrein B, plasma 1" 0.814 0.365 0.363 4.2e-47
UNIPROTKB|Q5FVS2638 Klkb1 "RCG59057, isoform CRA_a 0.814 0.365 0.363 4.2e-47
UNIPROTKB|F1SMT5 606 LOC100737499 "Uncharacterized 0.867 0.409 0.414 8.8e-47
UNIPROTKB|F1NSE5272 PRSS56 "Uncharacterized protei 0.825 0.867 0.406 3e-46
ZFIN|ZDB-GENE-091204-831045 tmprss15 "transmembrane protea 0.793 0.217 0.407 4.8e-46
UNIPROTKB|H0YAC1686 KLKB1 "Plasma kallikrein heavy 0.804 0.335 0.371 6.2e-46
FB|FBgn0002926 ndl "nudel" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 687 (246.9 bits), Expect = 5.9e-66, P = 5.9e-66
 Identities = 125/247 (50%), Positives = 170/247 (68%)

Query:    40 ILGSGRVVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVY 99
             I+G GR+VGG       WP+++A+YR+G FHCGG +  + W+++AAHCV  + K+++EV 
Sbjct:  1139 IVGDGRIVGGSYTSALQWPFVVAIYRNGKFHCGGTIYSDRWIISAAHCVINYGKYFYEVR 1198

Query:   100 AGMLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVT 159
             AG+LRR S+SP  Q++PVS +V+H  ++R  M NDL+LL+L  PL++NR+V+PICLPD  
Sbjct:  1199 AGLLRRSSYSPATQIQPVSHVVVHQAYERRSMRNDLSLLRLLNPLQFNRWVKPICLPDKG 1258

Query:   160 ET---------PEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILPACKHYEDRIADVICA 210
              T         P  ++ CT VGWGA+ E GP  D MR+V VPI   C   ED+ ++ ICA
Sbjct:  1259 RTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPIRKKCTDPEDQASEDICA 1318

Query:   211 GMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWL 270
             G P GGRD CQGDSGGPL C    +   +Y+AGVVSHG GCARP E GVYTRV+ ++ WL
Sbjct:  1319 GDPDGGRDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWL 1378

Query:   271 -MSNSER 276
              M+ + R
Sbjct:  1379 EMATTPR 1385


GO:0009950 "dorsal/ventral axis specification" evidence=IMP
GO:0016485 "protein processing" evidence=IGI
GO:0008063 "Toll signaling pathway" evidence=TAS
GO:0007313 "maternal specification of dorsal/ventral axis, oocyte, soma encoded" evidence=TAS
GO:0007306 "eggshell chorion assembly" evidence=IMP
GO:0008236 "serine-type peptidase activity" evidence=NAS;TAS
GO:0007310 "oocyte dorsal/ventral axis specification" evidence=NAS
GO:0005576 "extracellular region" evidence=NAS
GO:0006508 "proteolysis" evidence=IEA;NAS;TAS
GO:0008233 "peptidase activity" evidence=TAS
GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS
GO:0007343 "egg activation" evidence=IMP
UNIPROTKB|F1Q3Q5 PRSS56 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:102849 Klkb1 "kallikrein B, plasma 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P0CW18 PRSS56 "Putative serine protease 56" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|67382 Klkb1 "kallikrein B, plasma 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5FVS2 Klkb1 "RCG59057, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMT5 LOC100737499 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSE5 PRSS56 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-83 tmprss15 "transmembrane protease, serine 15" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0YAC1 KLKB1 "Plasma kallikrein heavy chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P98159NUDEL_DROME3, ., 4, ., 2, 1, ., -0.50600.82860.0905yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.766
3rd Layer3.4.21.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 6e-95
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 3e-89
pfam00089218 pfam00089, Trypsin, Trypsin 2e-67
COG5640 413 COG5640, COG5640, Secreted trypsin-like serine pro 7e-25
pfam09342267 pfam09342, DUF1986, Domain of unknown function (DU 1e-15
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
 Score =  279 bits (715), Expect = 6e-95
 Identities = 97/235 (41%), Positives = 133/235 (56%), Gaps = 10/235 (4%)

Query: 46  VVGGKKAELGAWPWLIAL-YRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLR 104
           +VGG +A++G++PW ++L Y  G   CGG ++   WV+TAAHCV       + V  G   
Sbjct: 1   IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPSNYTVRLGSHD 60

Query: 105 RFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEP 164
             S     QV  V ++++H  +  +   ND+ALL+L  P+  +  VRPICLP        
Sbjct: 61  LSSNEGGGQVIKVKKVIVHPNYNPSTYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPA 120

Query: 165 YSTCTAVGWGAVFEHGPDPDHMREVQVPILP--ACKHYEDRIADV----ICAGMPQGGRD 218
            +TCT  GWG   E GP PD ++EV VPI+    CK        +    +CAG  +GG+D
Sbjct: 121 GTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKRAYSYGGTITDNMLCAGGLEGGKD 180

Query: 219 TCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSN 273
            CQGDSGGPL+C      GR  + G+VS G GCARPN PGVYTRVS ++ W+   
Sbjct: 181 ACQGDSGGPLVC---NDNGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT 232


Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232

>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|220189 pfam09342, DUF1986, Domain of unknown function (DUF1986) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 100.0
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 100.0
KOG3627|consensus256 100.0
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 100.0
COG5640 413 Secreted trypsin-like serine protease [Posttransla 99.97
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 99.79
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 99.61
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 99.22
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.62
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 98.56
PRK10898353 serine endoprotease; Provisional 98.51
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.5
PRK10139 455 serine endoprotease; Provisional 98.37
PRK10942 473 serine endoprotease; Provisional 98.31
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 97.51
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 95.91
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 93.4
COG0265347 DegQ Trypsin-like serine proteases, typically peri 91.36
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 88.51
KOG1421|consensus 955 84.87
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
Probab=100.00  E-value=2e-45  Score=308.03  Aligned_cols=225  Identities=43%  Similarity=0.832  Sum_probs=192.8

Q ss_pred             eecCeeCCCCccceEEEEeeC-CeEEeEEEEeeCCEEEeccCCcCCCCCceEEEEEeeeecccCCCCceEEeeeEEEECC
Q psy10841         46 VVGGKKAELGAWPWLIALYRD-GFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRRFSFSPTEQVRPVSRIVMHS  124 (286)
Q Consensus        46 i~~g~~a~~~~~Pw~v~i~~~-~~~~C~GtLIs~~~VLTaAhC~~~~~~~~~~v~~g~~~~~~~~~~~~~~~v~~~~~hp  124 (286)
                      |+||+++..++|||+|.|+.. ..++|+||||+++||||||||+.+.....+.|++|...........+.+.|.++++||
T Consensus         1 i~~G~~~~~~~~Pw~v~i~~~~~~~~C~GtlIs~~~VLTaAhC~~~~~~~~~~v~~g~~~~~~~~~~~~~~~v~~~~~hp   80 (232)
T cd00190           1 IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPSNYTVRLGSHDLSSNEGGGQVIKVKKVIVHP   80 (232)
T ss_pred             CcCCeECCCCCCCCEEEEEccCCcEEEEEEEeeCCEEEECHHhcCCCCCccEEEEeCcccccCCCCceEEEEEEEEEECC
Confidence            679999999999999999876 6789999999999999999999876567788999987765543456788999999999


Q ss_pred             CCCCCCCCCceEEEEecCccccCCceeeeecCCCCCCCCCCCceEEEEecccCCCCCCCccceeEeeeecc--ccccccc
Q psy10841        125 MFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILP--ACKHYED  202 (286)
Q Consensus       125 ~y~~~~~~~DiAllkL~~~i~~~~~v~picL~~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~--~c~~~~~  202 (286)
                      +|+.....+|||||||++++.++.+++||||+........+..+.++|||...........++...+.+++  .|...+.
T Consensus        81 ~y~~~~~~~DiAll~L~~~~~~~~~v~picl~~~~~~~~~~~~~~~~G~g~~~~~~~~~~~~~~~~~~~~~~~~C~~~~~  160 (232)
T cd00190          81 NYNPSTYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKRAYS  160 (232)
T ss_pred             CCCCCCCcCCEEEEEECCcccCCCcccceECCCccccCCCCCEEEEEeCCcCCCCCCCCceeeEEEeeeECHHHhhhhcc
Confidence            99998889999999999999999999999999865456677899999999876554566778888888877  5876543


Q ss_pred             ----CCCCEEEEeeCCCCCCCCCCCCCCeeeeecCCCCCcEEEEEEEEecCCCCCCCCCeeEEeCCCcHHHHHhh
Q psy10841        203 ----RIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSN  273 (286)
Q Consensus       203 ----~~~~~~C~~~~~~~~~~c~gdsGgPL~~~~~~~~~~~~lvGI~s~~~~c~~~~~p~v~t~v~~~~~WI~~~  273 (286)
                          ..+.++|+.........|.|||||||++..   +++++|+||+|++..|.....|.+|++|++|.+||+++
T Consensus       161 ~~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~---~~~~~lvGI~s~g~~c~~~~~~~~~t~v~~~~~WI~~~  232 (232)
T cd00190         161 YGGTITDNMLCAGGLEGGKDACQGDSGGPLVCND---NGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT  232 (232)
T ss_pred             CcccCCCceEeeCCCCCCCccccCCCCCcEEEEe---CCEEEEEEEEehhhccCCCCCCCEEEEcHHhhHHhhcC
Confidence                567899998654467899999999999876   58899999999999888656799999999999999864



Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.

>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2any_A241 Expression, Crystallization And The Three-Dimension 4e-45
2anw_A241 Expression, Crystallization And Three-Dimensional S 5e-45
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 6e-44
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 2e-43
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 2e-41
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 6e-41
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 1e-40
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 1e-40
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 1e-39
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 2e-39
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 2e-39
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 2e-39
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 2e-39
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 2e-39
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 7e-39
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 3e-38
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 5e-38
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 6e-38
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 8e-38
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 8e-38
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 9e-38
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 1e-37
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 2e-37
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 4e-37
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 5e-37
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 8e-37
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 8e-37
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 9e-37
1lto_A245 Human Alpha1-Tryptase Length = 245 9e-37
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 1e-36
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 3e-36
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 3e-36
1pfx_C235 Porcine Factor Ixa Length = 235 4e-36
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 5e-36
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 6e-36
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 9e-36
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 1e-35
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 2e-35
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 6e-35
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 6e-35
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 1e-34
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 1e-34
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 1e-34
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 1e-34
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 1e-34
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 1e-34
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 2e-34
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 6e-34
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 8e-34
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 1e-33
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 1e-33
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 1e-33
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 2e-33
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 2e-33
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 2e-33
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 3e-33
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 3e-33
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 3e-33
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 4e-33
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 5e-33
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 5e-33
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 6e-33
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 6e-33
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 7e-33
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 7e-33
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 7e-33
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 7e-33
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 7e-33
1dpo_A223 Structure Of Rat Trypsin Length = 223 8e-33
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 9e-33
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 1e-32
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 1e-32
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 1e-32
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 1e-32
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 1e-32
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 1e-32
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 1e-32
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 1e-32
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 1e-32
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 2e-32
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 2e-32
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 2e-32
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 2e-32
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 3e-32
1sgf_A240 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 3e-32
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 3e-32
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 4e-32
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 4e-32
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 4e-32
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 5e-32
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 5e-32
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 6e-32
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 6e-32
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 6e-32
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 7e-32
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 7e-32
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 8e-32
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 9e-32
1bru_P241 Structure Of Porcine Pancreatic Elastase Complexed 9e-32
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 1e-31
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 1e-31
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 1e-31
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 1e-31
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 2e-31
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 2e-31
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 2e-31
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 2e-31
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 2e-31
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 2e-31
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 2e-31
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 2e-31
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 2e-31
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 2e-31
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 3e-31
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 4e-31
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 4e-31
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 4e-31
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 4e-31
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 5e-31
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 5e-31
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 5e-31
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 6e-31
1gdu_A224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 7e-31
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 7e-31
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 9e-31
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 9e-31
1xvm_A224 Trypsin From Fusarium Oxysporum- Room Temperature T 2e-30
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 2e-30
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 2e-30
1ppz_A224 Trypsin Complexes At Atomic And Ultra-High Resoluti 3e-30
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 3e-30
2bok_A241 Factor Xa- Cation Length = 241 3e-30
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 3e-30
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 3e-30
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 3e-30
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 4e-30
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 4e-30
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 4e-30
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 4e-30
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 5e-30
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 5e-30
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 5e-30
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 6e-30
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 6e-30
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 6e-30
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 6e-30
2xrc_A565 Human Complement Factor I Length = 565 7e-30
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 8e-30
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 9e-30
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 1e-29
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 1e-29
1mh0_A287 Crystal Structure Of The Anticoagulant Slow Form Of 1e-29
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 1e-29
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 1e-29
1hag_E295 The Isomorphous Structures Of Prethrombin2, Hirugen 1e-29
1kig_H241 Bovine Factor Xa Length = 241 1e-29
1nu9_A291 Staphylocoagulase-prethrombin-2 Complex Length = 29 1e-29
2bdy_A289 Thrombin In Complex With Inhibitor Length = 289 1e-29
1d9i_A288 Structure Of Thrombin Complexed With Selective Non- 1e-29
1d6w_A287 Structure Of Thrombin Complexed With Selective Non- 2e-29
1nm6_A287 Thrombin In Complex With Selective Macrocyclic Inhi 2e-29
1eoj_A289 Design Of P1' And P3' Residues Of Trivalent Thrombi 2e-29
1jwt_A305 Crystal Structure Of Thrombin In Complex With A Nov 2e-29
3nxp_A424 Crystal Structure Of Human Prethrombin-1 Length = 4 2e-29
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 2e-29
2a31_A223 Trypsin In Complex With Borate Length = 223 2e-29
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-29
3sqe_E290 Crystal Structure Of Prethrombin-2 Mutant S195a In 3e-29
3k65_B308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 3e-29
1h8i_H253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 3e-29
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 3e-29
2bvr_H252 Human Thrombin Complexed With Fragment-based Small 3e-29
1vzq_H250 Complex Of Thrombin With Designed Inhibitor 7165 Le 3e-29
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 4e-29
1h8d_H260 X-Ray Structure Of The Human Alpha-Thrombin Complex 6e-29
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 7e-29
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 7e-29
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 8e-29
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 8e-29
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 8e-29
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 9e-29
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 1e-28
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 1e-28
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 2e-28
1mkw_K308 The Co-Crystal Structure Of Unliganded Bovine Alpha 2e-28
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 2e-28
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 3e-28
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 3e-28
1elt_A236 Structure Of Native Pancreatic Elastase From North 3e-28
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 3e-28
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 3e-28
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 3e-28
1aut_C250 Human Activated Protein C Length = 250 4e-28
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 4e-28
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 4e-28
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 4e-28
3i77_A230 3599170-Loops Of Fxa In Sgt Length = 230 4e-28
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 5e-28
1bth_H259 Structure Of Thrombin Complexed With Bovine Pancrea 6e-28
1ton_A235 Rat Submaxillary Gland Serine Protease, Tonin. Stru 6e-28
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 6e-28
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 7e-28
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 7e-28
1dm4_B260 Ser195ala Mutant Of Human Thrombin Complexed With F 8e-28
1hax_B240 Snapshots Of Serine Protease Catalysis: (A) Acyl-En 8e-28
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 8e-28
2est_E240 Crystallographic Study Of The Binding Of A Trifluor 8e-28
3r3g_B259 Structure Of Human Thrombin With Residues 145-150 O 1e-27
1sfq_B259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 1e-27
2a0q_B257 Structure Of Thrombin In 400 Mm Potassium Chloride 1e-27
1b7x_B259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 1e-27
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 1e-27
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 1e-27
1abi_H259 Structure Of The Hirulog 3-Thrombin Complex And Nat 1e-27
3gic_B250 Structure Of Thrombin Mutant Delta(146-149e) In The 1e-27
1gj5_H258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 1e-27
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 1e-27
1eai_A240 Complex Of Ascaris Chymotrpsin/elastase Inhibitor W 1e-27
1qur_H257 Human Alpha-Thrombin In Complex With Bivalent, Benz 1e-27
2thf_B259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 2e-27
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 2e-27
3jz1_B259 Crystal Structure Of Human Thrombin Mutant N143p In 2e-27
2ocv_B259 Structural Basis Of Na+ Activation Mimicry In Murin 2e-27
1dx5_M259 Crystal Structure Of The Thrombin-Thrombomodulin Co 2e-27
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 3e-27
1jou_B259 Crystal Structure Of Native S195a Thrombin With An 3e-27
2od3_B259 Human Thrombin Chimera With Human Residues 184a, 18 3e-27
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 4e-27
2gp9_B259 Crystal Structure Of The Slow Form Of Thrombin In A 4e-27
1z8i_B259 Crystal Structure Of The Thrombin Mutant G193a Boun 5e-27
4gso_A232 Structure Of Jararacussin-I Length = 232 5e-27
3ee0_B259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 6e-27
1tq0_B257 Crystal Structure Of The Potent Anticoagulant Throm 6e-27
1pyt_C253 Ternary Complex Of Procarboxypeptidase A, Proprotei 6e-27
2xxl_A408 Crystal Structure Of Drosophila Grass Clip Serine P 6e-27
2pux_B258 Crystal Structure Of Murine Thrombin In Complex Wit 7e-27
1wbg_B259 Active Site Thrombin Inhibitors Length = 259 8e-27
3i78_A229 3599170186220-Loops Of Fxa In Sgt Length = 229 1e-26
1z8j_B259 Crystal Structure Of The Thrombin Mutant G193p Boun 1e-26
3edx_B258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 1e-26
1bbr_K259 The Structure Of Residues 7-16 Of The A Alpha Chain 2e-26
1id5_H256 Crystal Structure Of Bovine Thrombin Complex With P 3e-26
2b9l_A394 Crystal Structure Of Prophenoloxidase Activating Fa 3e-26
3beu_A224 Na+-Dependent Allostery Mediates Coagulation Factor 4e-26
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 4e-26
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 5e-26
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 7e-26
1vr1_H261 Specifity For Plasminogen Activator Inhibitor-1 Len 9e-26
2pgb_B259 Inhibitor-Free Human Thrombin Mutant C191a-C220a Le 1e-25
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 1e-25
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 1e-25
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 2e-25
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 4e-25
2fmj_A222 220-Loop Mutant Of Streptomyces Griseus Trypsin Len 4e-25
1fi8_A228 Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie 5e-25
1os8_A223 Recombinant Streptomyces Griseus Trypsin Length = 2 6e-25
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 6e-25
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 7e-25
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 1e-24
1m9u_A241 Crystal Structure Of Earthworm Fibrinolytic Enzyme 1e-24
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 2e-24
1sgt_A223 Refined Crystal Structure Of Streptomyces Griseus T 2e-24
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 2e-24
1orf_A234 The Oligomeric Structure Of Human Granzyme A Reveal 2e-24
1op8_A234 Crystal Structure Of Human Granzyme A Length = 234 3e-24
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 3e-24
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 4e-24
1oss_A223 T190p Streptomyces Griseus Trypsin In Complex With 5e-24
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 5e-24
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 7e-24
1fon_A240 Crystal Structure Of Bovine Procarboxypeptidase A-S 7e-24
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 8e-24
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 1e-23
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 1e-23
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 1e-23
1euf_A227 Bovine Duodenase(New Serine Protease), Crystal Stru 1e-23
1fq3_A227 Crystal Structure Of Human Granzyme B Length = 227 1e-23
1iau_A227 Human Granzyme B In Complex With Ac-Iepd-Cho Length 2e-23
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 4e-23
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 4e-23
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 5e-23
1md8_A329 Monomeric Structure Of The Active Catalytic Domain 7e-23
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 9e-23
1md7_A328 Monomeric Structure Of The Zymogen Of Complement Pr 1e-22
4gaw_A226 Crystal Structure Of Active Human Granzyme H Length 2e-22
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 3e-22
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 3e-22
3tju_A226 Crystal Structure Of Human Granzyme H With An Inhib 5e-22
2qy0_B242 Active Dimeric Structure Of The Catalytic Domain Of 2e-21
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 2e-21
2zgc_A240 Crystal Structure Of Active Human Granzyme M Length 3e-21
1fuj_A221 Pr3 (Myeloblastin) Length = 221 6e-21
2zgj_A240 Crystal Structure Of D86n-gzmm Complexed With Its O 1e-20
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 2e-20
1gvz_A237 Prostate Specific Antigen (Psa) From Stallion Semin 3e-20
1azz_A226 Fiddler Crab Collagenase Complexed To Ecotin Length 3e-20
1si5_H240 Protease-Like Domain From 2-Chain Hepatocyte Growth 4e-20
1shy_A234 The Crystal Structure Of Hgf Beta-Chain In Complex 4e-20
2rdl_A226 Hamster Chymase 2 Length = 226 5e-20
3g01_A227 Structure Of Grc Mutant E192rE193G Length = 227 6e-20
3s69_A234 Crystal Structure Of Saxthrombin Length = 234 6e-20
3rp2_A224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 1e-19
1kyn_B235 Cathepsin-G Length = 235 3e-19
3fzz_A227 Structure Of Grc Length = 227 3e-19
1au8_A224 Human Cathepsin G Length = 224 3e-19
1nn6_A228 Human Pro-Chymase Length = 228 1e-18
1pjp_A226 The 2.2 A Crystal Structure Of Human Chymase In Com 2e-18
1klt_A226 Crystal Structure Of Pmsf-Treated Human Chymase At 2e-18
2kai_B152 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 3e-18
3n7o_A226 X-Ray Structure Of Human Chymase In Complex With Sm 3e-18
4afq_A226 Human Chymase - Fynomer Complex Length = 226 4e-18
1mtn_B131 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 9e-18
2jet_B128 Crystal Structure Of A Trypsin-Like Mutant (S189d, 2e-17
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 2e-17
1kdq_A131 Crystal Structure Analysis Of The Mutant S189d Rat 3e-17
1ppg_E218 The Refined 2.3 Angstroms Crystal Structure Of Huma 7e-17
1ppf_E218 X-Ray Crystal Structure Of The Complex Of Human Leu 8e-17
1hne_E218 Structure Of Human Neutrophil Elastase In Complex W 1e-16
1b0f_A218 Crystal Structure Of Human Neutrophil Elastase With 1e-16
2asu_B234 Crystal Structure Of The Beta-Chain Of HgflMSP Leng 2e-16
2rg3_A218 Covalent Complex Structure Of Elastase Length = 218 3e-16
1hyl_A230 The 1.8 A Structure Of Collagenase From Hypoderma L 9e-15
1fy1_A225 [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P 3e-14
4f4o_C347 Structure Of The Haptoglobin-Haemoglobin Complex Le 3e-14
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 4e-14
1fy3_A225 [g175q]hbp, A Mutant Of Human Heparin Binding Prote 4e-14
1a7s_A225 Atomic Resolution Structure Of Hbp Length = 225 4e-14
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 1e-13
3h7t_A235 Crystal Structure Of Scabies Mite Inactivated Prote 7e-13
2jet_C99 Crystal Structure Of A Trypsin-Like Mutant (S189d, 1e-12
1bhx_B147 X-Ray Structure Of The Complex Of Human Alpha Throm 1e-12
1kdq_B99 Crystal Structure Analysis Of The Mutant S189d Rat 5e-12
1bbr_H150 The Structure Of Residues 7-16 Of The A Alpha Chain 6e-12
1mtn_C97 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 1e-11
1afq_C96 Crystal Structure Of Bovine Gamma-Chymotrypsin Comp 2e-11
3h7o_A228 Crystal Structure Of Scabies Mite Inactivated Prote 4e-11
2hnt_F105 Crystallographic Structure Of Human Gamma-Thrombin 4e-10
2pks_C102 Thrombin In Complex With Inhibitor Length = 102 4e-10
1bbr_E109 The Structure Of Residues 7-16 Of The A Alpha Chain 5e-10
1aks_A125 Crystal Structure Of The First Active Autolysate Fo 9e-10
2win_I507 C3 Convertase (C3bbb) Stabilized By Scin Length = 5 2e-08
1rrk_A497 Crystal Structure Analysis Of The Bb Segment Of Fac 3e-08
2ok5_A752 Human Complement Factor B Length = 752 3e-08
2kai_A80 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 4e-08
2xwb_F732 Crystal Structure Of Complement C3b In Complex With 4e-08
3hrz_D741 Cobra Venom Factor (Cvf) In Complex With Human Fact 4e-08
1dle_A298 Factor B Serine Protease Domain Length = 298 6e-08
2i6q_A517 Complement Component C2a Length = 517 2e-05
2odp_A509 Complement Component C2a, The Catalytic Fragment Of 3e-05
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 1e-04
3f1s_B283 Crystal Structure Of Protein Z Complexed With Prote 2e-04
2hnt_C70 Crystallographic Structure Of Human Gamma-Thrombin 3e-04
2hnt_E81 Crystallographic Structure Of Human Gamma-Thrombin 7e-04
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure

Iteration: 1

Score = 177 bits (450), Expect = 4e-45, Method: Compositional matrix adjust. Identities = 86/241 (35%), Positives = 141/241 (58%), Gaps = 12/241 (4%) Query: 46 VVGGKKAELGAWPWLIALYRDGFFH---CGGVVLDESWVMTAAHCVDGFE-KHYFEVYAG 101 +VGG ++ G WPW ++L CGG ++ WV+TAAHC DG + + +Y+G Sbjct: 1 IVGGTESSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSG 60 Query: 102 MLRRFSFSPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTET 161 +L + + I++H +K +E +D+AL++L APL Y + +PI LP +T Sbjct: 61 ILELSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPSKGDT 120 Query: 162 PEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILP--AC-KHYED-RIAD-VICAGMPQGG 216 Y+ C GWG E G + +++V +P++ C K Y+D +I ++CAG +GG Sbjct: 121 STIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGG 180 Query: 217 RDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSER 276 +D C+GDSGGPL+C G W + G+ S GEGCAR +PGVYT+V++++ W++ ++ Sbjct: 181 KDACKGDSGGPLVCK---HNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQS 237 Query: 277 A 277 + Sbjct: 238 S 238
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 Back     alignment and structure
>pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure
>pdb|3BEU|A Chain A, Na+-Dependent Allostery Mediates Coagulation Factor Protease Active Site Selectivity Length = 224 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|2FMJ|A Chain A, 220-Loop Mutant Of Streptomyces Griseus Trypsin Length = 222 Back     alignment and structure
>pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 Back     alignment and structure
>pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure
>pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|1OSS|A Chain A, T190p Streptomyces Griseus Trypsin In Complex With Benzamidine Length = 223 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 Back     alignment and structure
>pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 Back     alignment and structure
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 Back     alignment and structure
>pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 Back     alignment and structure
>pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 Back     alignment and structure
>pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 Back     alignment and structure
>pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 Back     alignment and structure
>pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 Back     alignment and structure
>pdb|2RDL|A Chain A, Hamster Chymase 2 Length = 226 Back     alignment and structure
>pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 Back     alignment and structure
>pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 Back     alignment and structure
>pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 Back     alignment and structure
>pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 Back     alignment and structure
>pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 Back     alignment and structure
>pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 Back     alignment and structure
>pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 Back     alignment and structure
>pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|1KDQ|A Chain A, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 131 Back     alignment and structure
>pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 Back     alignment and structure
>pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 Back     alignment and structure
>pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 Back     alignment and structure
>pdb|2ASU|B Chain B, Crystal Structure Of The Beta-Chain Of HgflMSP Length = 234 Back     alignment and structure
>pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 Back     alignment and structure
>pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 Back     alignment and structure
>pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 Back     alignment and structure
>pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 Back     alignment and structure
>pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|3H7T|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-D1 (Smipp-S-D1) Length = 235 Back     alignment and structure
>pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 Back     alignment and structure
>pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 Back     alignment and structure
>pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 Back     alignment and structure
>pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 Back     alignment and structure
>pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 Back     alignment and structure
>pdb|3H7O|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-I1 (Smipp-S-I1) Length = 228 Back     alignment and structure
>pdb|2HNT|F Chain F, Crystallographic Structure Of Human Gamma-Thrombin Length = 105 Back     alignment and structure
>pdb|2PKS|C Chain C, Thrombin In Complex With Inhibitor Length = 102 Back     alignment and structure
>pdb|1BBR|E Chain E, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 109 Back     alignment and structure
>pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 Back     alignment and structure
>pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 Back     alignment and structure
>pdb|1RRK|A Chain A, Crystal Structure Analysis Of The Bb Segment Of Factor B Length = 497 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|2KAI|A Chain A, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 80 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|1DLE|A Chain A, Factor B Serine Protease Domain Length = 298 Back     alignment and structure
>pdb|2I6Q|A Chain A, Complement Component C2a Length = 517 Back     alignment and structure
>pdb|2ODP|A Chain A, Complement Component C2a, The Catalytic Fragment Of C3- And C5- Convertase Of Human Complement Length = 509 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|3F1S|B Chain B, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 283 Back     alignment and structure
>pdb|2HNT|C Chain C, Crystallographic Structure Of Human Gamma-Thrombin Length = 70 Back     alignment and structure
>pdb|2HNT|E Chain E, Crystallographic Structure Of Human Gamma-Thrombin Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 1e-106
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 1e-102
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 1e-102
3bg8_A238 Coagulation factor XIA light chain; protease inhib 1e-102
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 1e-102
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 1e-102
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 1e-101
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 1e-101
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 1e-101
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 1e-100
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 1e-100
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 1e-99
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 3e-97
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 4e-97
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 1e-96
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 1e-96
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 2e-96
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 5e-96
1aut_C250 Activated protein C; serine proteinase, plasma cal 2e-95
2r0l_A248 Hepatocyte growth factor activator; serine proteas 4e-95
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 3e-94
2jde_A276 Urokinase-type plasminogen activator; plasminogen 4e-94
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 6e-94
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 2e-93
2xrc_A565 Human complement factor I; immune system, hydrolas 2e-93
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 3e-93
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 7e-93
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 9e-93
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 1e-92
2qy0_B242 Complement C1R subcomponent; serine protease, beta 1e-92
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 1e-92
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 2e-92
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 2e-92
1md8_A329 C1R complement serine protease; innate immunity, a 3e-92
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 1e-91
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 1e-91
2xw9_A228 Complement factor D; immune system, hydrolase, ser 2e-91
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 7e-91
1gpz_A399 Complement C1R component; hydrolase, activation, i 7e-91
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 1e-90
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 1e-90
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 2e-90
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 2e-90
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 3e-90
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 5e-90
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 5e-90
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 6e-90
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 1e-89
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 2e-89
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 2e-89
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 4e-89
1ao5_A237 Glandular kallikrein-13; serine protease, protein 4e-89
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 5e-89
2z7f_E218 Leukocyte elastase; serine protease, serine protea 8e-89
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 7e-88
1a7s_A225 Heparin binding protein; serine protease homolog, 9e-88
2asu_B234 Hepatocyte growth factor-like protein; serine prot 1e-87
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 1e-87
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 4e-87
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 4e-87
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 5e-87
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 1e-86
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 1e-86
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 2e-86
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 6e-86
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 6e-86
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 7e-86
1elv_A333 Complement C1S component; trypsin-like serin prote 2e-85
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 2e-85
2aiq_A231 Protein C activator; snake venom serine proteinase 3e-85
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 3e-85
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 3e-85
1euf_A227 Duodenase; serine protease, dual specificity, hydr 5e-85
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 5e-85
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 6e-85
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 6e-85
2xxl_A408 GRAM-positive specific serine protease, isoform B; 1e-84
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 1e-84
1azz_A226 Collagenase; complex (serine protease/inhibitor), 2e-84
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 2e-84
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 3e-84
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 9e-83
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 3e-79
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-79
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 5e-75
2odp_A509 Complement C2; C3/C5 convertase, complement serin 1e-74
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 1e-73
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 1e-72
3hrz_D741 Complement factor B; serine protease, glycosilated 7e-63
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 3e-54
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 7e-49
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 3e-37
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 3e-23
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 3e-19
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 4e-11
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 5e-05
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 7e-04
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
 Score =  306 bits (786), Expect = e-106
 Identities = 91/236 (38%), Positives = 130/236 (55%), Gaps = 11/236 (4%)

Query: 46  VVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEK--HYFEVYAGML 103
           +VGG  A+ GAWPW++ LY D    CG  ++   W+++AAHCV G       +    G+ 
Sbjct: 1   IVGGSDAKEGAWPWVVGLYYDDRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAILGLH 60

Query: 104 RRFSF-SPTEQVRPVSRIVMHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETP 162
            + +  SP    R +  IV++  + R    ND+A++ L   + Y  Y++PI LP+  +  
Sbjct: 61  MKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPISLPEENQVF 120

Query: 163 EPYSTCTAVGWGAVFEHGPDPDHMREVQVPILP--ACKH--YEDRI-ADVICAGMPQGGR 217
            P   C+  GWG V   G   D ++E  VP+L    C+    E  I  ++ICAG  +GG 
Sbjct: 121 PPGRNCSIAGWGTVVYQGTTADILQEADVPLLSNERCQQQMPEYNITENMICAGYEEGGI 180

Query: 218 DTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSN 273
           D+CQGDSGGPL+C       RW++AGV S G  CA PN PGVY RVS+F  W+ S 
Sbjct: 181 DSCQGDSGGPLMCQE---NNRWFLAGVTSFGYECALPNRPGVYARVSRFTEWIQSF 233


>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
3bg8_A238 Coagulation factor XIA light chain; protease inhib 100.0
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 100.0
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 100.0
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 100.0
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 100.0
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 100.0
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 100.0
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 100.0
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 100.0
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 100.0
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 100.0
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 100.0
2jde_A276 Urokinase-type plasminogen activator; plasminogen 100.0
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 100.0
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 100.0
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 100.0
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 100.0
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 100.0
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 100.0
1aut_C250 Activated protein C; serine proteinase, plasma cal 100.0
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 100.0
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 100.0
2r0l_A248 Hepatocyte growth factor activator; serine proteas 100.0
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 100.0
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 100.0
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 100.0
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 100.0
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 100.0
2xw9_A228 Complement factor D; immune system, hydrolase, ser 100.0
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 100.0
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 100.0
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 100.0
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 100.0
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 100.0
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 100.0
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 100.0
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 100.0
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 100.0
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 100.0
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 100.0
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 100.0
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 100.0
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 100.0
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 100.0
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 100.0
1ao5_A237 Glandular kallikrein-13; serine protease, protein 100.0
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 100.0
1euf_A227 Duodenase; serine protease, dual specificity, hydr 100.0
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 100.0
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 100.0
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 100.0
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 100.0
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 100.0
2z7f_E218 Leukocyte elastase; serine protease, serine protea 100.0
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 100.0
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 100.0
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 100.0
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 100.0
2xxl_A408 GRAM-positive specific serine protease, isoform B; 100.0
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 100.0
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 100.0
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 100.0
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 100.0
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 100.0
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 100.0
1a7s_A225 Heparin binding protein; serine protease homolog, 100.0
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 100.0
2asu_B234 Hepatocyte growth factor-like protein; serine prot 100.0
1azz_A226 Collagenase; complex (serine protease/inhibitor), 100.0
2qy0_B242 Complement C1R subcomponent; serine protease, beta 100.0
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 100.0
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 100.0
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 100.0
1elv_A333 Complement C1S component; trypsin-like serin prote 100.0
1md8_A329 C1R complement serine protease; innate immunity, a 100.0
2aiq_A231 Protein C activator; snake venom serine proteinase 100.0
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 100.0
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 100.0
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 100.0
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 100.0
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 100.0
2xrc_A565 Human complement factor I; immune system, hydrolas 100.0
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 100.0
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 100.0
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 100.0
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 100.0
1gpz_A399 Complement C1R component; hydrolase, activation, i 100.0
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 100.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 100.0
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 100.0
2odp_A509 Complement C2; C3/C5 convertase, complement serin 100.0
3hrz_D741 Complement factor B; serine protease, glycosilated 100.0
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 100.0
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 100.0
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.97
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.97
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.96
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.96
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.96
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.96
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.95
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.95
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.91
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.91
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.91
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.89
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.84
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.82
3k6y_A237 Serine protease, possible membrane-associated seri 99.75
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.72
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.71
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.7
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.67
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.66
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.61
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.58
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.56
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.54
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.46
1hpg_A187 Glutamic acid specific protease; serine protease, 99.44
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 99.4
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.27
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.2
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.18
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.02
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 98.93
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 98.7
2w5e_A163 Putative serine protease; coiled coil, transmembra 98.62
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 98.59
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.48
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 98.37
3syj_A 1011 Adhesion and penetration protein autotransporter; 96.95
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 96.67
1lvm_A229 Catalytic domain of the nuclear inclusion protein 96.54
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 96.46
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 95.67
3h09_A 989 IGA1 protease, immunoglobulin A1 protease; serine 94.78
3sze_A 968 Serine protease ESPP; parallel beta-helix, hydrola 94.22
4ash_A185 NS6 protease; hydrolase, trypsin-like, calicivirus 93.09
2fyq_A194 Chymotrypsin-like cysteine proteinase; protease, n 91.99
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
Probab=100.00  E-value=7.3e-54  Score=360.74  Aligned_cols=228  Identities=35%  Similarity=0.775  Sum_probs=198.4

Q ss_pred             eecCeeCCCCccceEEEEee---CCeEEeEEEEeeCCEEEeccCCcCCCC-CceEEEEEeeeecccCCCCceEEeeeEEE
Q psy10841         46 VVGGKKAELGAWPWLIALYR---DGFFHCGGVVLDESWVMTAAHCVDGFE-KHYFEVYAGMLRRFSFSPTEQVRPVSRIV  121 (286)
Q Consensus        46 i~~g~~a~~~~~Pw~v~i~~---~~~~~C~GtLIs~~~VLTaAhC~~~~~-~~~~~v~~g~~~~~~~~~~~~~~~v~~~~  121 (286)
                      |+||++|..++|||+|+|+.   .+.++|+||||+++||||||||+.... ...+.|++|..+........+.+.|++++
T Consensus         1 IvgG~~a~~~~~Pw~v~l~~~~~~~~~~CgGtLI~~~~VLTAAHC~~~~~~~~~~~v~~G~~~~~~~~~~~~~~~v~~i~   80 (238)
T 3bg8_A            1 IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEII   80 (238)
T ss_dssp             CBSCEECCTTSSTTEEEEEECSSSCEEEEEEEEEETTEEEECGGGGTTCCCGGGEEEECSCSBGGGCCTTSCCEEEEEEE
T ss_pred             CCCCeECCCCCcCcEEEEEeecCCCcEEEEEEEeeCCEEEECHHHCCCCCCCceEEEEEeeccCCcCCCCceEEeeEEEE
Confidence            68999999999999999976   457899999999999999999997643 35788999988876655567788999999


Q ss_pred             ECCCCCCCCCCCceEEEEecCccccCCceeeeecCCCCCCCCCCCceEEEEecccCCCCCCCccceeEeeeecc--cccc
Q psy10841        122 MHSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILP--ACKH  199 (286)
Q Consensus       122 ~hp~y~~~~~~~DiAllkL~~~i~~~~~v~picL~~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~--~c~~  199 (286)
                      +||+|+.....+|||||||++|+.|++.++|||||........+..++++|||.+...+..+..|+++.+++++  +|+.
T Consensus        81 ~Hp~y~~~~~~~DIALl~L~~~v~~~~~v~picLp~~~~~~~~~~~~~v~GwG~~~~~~~~~~~L~~~~~~~~~~~~C~~  160 (238)
T 3bg8_A           81 IHDQYKMAESGYDIALLKLETTVNYTDSQRPISLPSKGERNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK  160 (238)
T ss_dssp             ECTTCCCGGGSCCCEEEEESSCCCCBTTBCCCBCCCGGGGSSCCCCEEEEESCCSSSSCCCCSBCEEEECCEECHHHHHH
T ss_pred             ECCCCCCCCCCCcEEEEEECCccccCCCcccCCCCCCccCcCCCCeEEEEecCCCCCCCChhhhhcEeeEEEECHHHhhh
Confidence            99999988888999999999999999999999999865445667899999999887666667889999999888  5876


Q ss_pred             ccc---CCCCEEEEeeCCCCCCCCCCCCCCeeeeecCCCCCcEEEEEEEEecCCCCCCCCCeeEEeCCCcHHHHHhhhcc
Q psy10841        200 YED---RIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSER  276 (286)
Q Consensus       200 ~~~---~~~~~~C~~~~~~~~~~c~gdsGgPL~~~~~~~~~~~~lvGI~s~~~~c~~~~~p~v~t~v~~~~~WI~~~~~~  276 (286)
                      .+.   ..+.+||++......+.|.|||||||++..   +++|+|+||+||+..|+..+.|++||||++|++||+++++.
T Consensus       161 ~~~~~~~~~~~~Ca~~~~~~~~~C~GDSGgPL~~~~---~~~~~l~GI~S~g~~C~~~~~p~vyt~V~~y~~WI~~~~~~  237 (238)
T 3bg8_A          161 RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKH---NEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQA  237 (238)
T ss_dssp             HCTTSCCCTTEEEECCTTCCCBCCTTCTTCEEEEEE---TTEEEEEEEEEECSSSSCTTCCEEEEEGGGGHHHHHHHHSC
T ss_pred             hhcCCCCCCCeEeecCCCCCCCcCCCCCCcceEEEE---CCeEEEEEEEEECCCCCCCCCCcEEEeHHHHHHHHHHHHhc
Confidence            543   567899998655677899999999999976   67999999999999998778899999999999999998864



>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>3h09_A IGA1 protease, immunoglobulin A1 protease; serine protease, beta helix, hydrolase, M protease, secreted, transmembrane, virulence; 1.75A {Haemophilus influenzae} Back     alignment and structure
>3sze_A Serine protease ESPP; parallel beta-helix, hydrolase; 2.50A {Escherichia coli O157} Back     alignment and structure
>4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} Back     alignment and structure
>2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 5e-58
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 2e-57
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 3e-53
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 3e-52
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 6e-52
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 8e-52
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 2e-51
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 7e-51
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 2e-49
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 2e-48
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 6e-48
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 2e-47
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 2e-47
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 3e-47
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 2e-46
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 2e-46
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 3e-45
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 5e-45
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 6e-45
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 8e-45
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 9e-45
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 9e-45
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 1e-44
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 2e-44
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 7e-44
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 9e-44
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 9e-44
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 3e-43
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 7e-43
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 8e-43
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 1e-42
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 1e-42
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 2e-42
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 2e-42
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 2e-42
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 2e-41
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 2e-41
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 5e-41
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 2e-40
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 2e-40
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 4e-40
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 4e-40
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 9e-40
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 1e-39
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 2e-39
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 2e-39
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 9e-39
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 5e-38
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 2e-37
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 3e-37
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 1e-36
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 2e-36
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 5e-36
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 3e-35
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 3e-34
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 3e-29
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 6e-28
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 2e-26
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 3e-18
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 2e-13
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 1e-06
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 4e-05
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Hepsin, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  184 bits (467), Expect = 5e-58
 Identities = 86/241 (35%), Positives = 118/241 (48%), Gaps = 13/241 (5%)

Query: 46  VVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEKHYFEVYAGMLRR 105
           +VGG+   LG WPW ++L  DG   CGG +L   WV+TAAHC     +            
Sbjct: 1   IVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAV 60

Query: 106 FSFSPTEQVRPVSRIVMHSM------FKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVT 159
              SP      V  +V H            E +ND+AL+ L++PL    Y++P+CLP   
Sbjct: 61  AQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAG 120

Query: 160 ETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILP------ACKHYEDRIADVICAGMP 213
           +       CT  GWG    +G     ++E +VPI+       A  +       + CAG P
Sbjct: 121 QALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYP 180

Query: 214 QGGRDTCQGDSGGPLLCPVPGSQ-GRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMS 272
           +GG D CQGDSGGP +C    S+  RW + G+VS G GCA   +PGVYT+VS F  W+  
Sbjct: 181 EGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQ 240

Query: 273 N 273
            
Sbjct: 241 A 241


>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 100.0
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 100.0
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 100.0
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 100.0
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 100.0
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 100.0
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 100.0
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 100.0
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 100.0
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 100.0
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 100.0
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 100.0
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 100.0
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 100.0
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 100.0
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 100.0
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 100.0
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 100.0
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 100.0
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 100.0
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 100.0
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 100.0
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 100.0
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 100.0
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 100.0
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1elva1259 Complement C1S protease, catalytic domain {Human ( 100.0
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 100.0
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 100.0
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 100.0
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 100.0
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 100.0
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 100.0
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 100.0
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 100.0
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 100.0
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 100.0
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 100.0
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 100.0
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.93
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.92
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.76
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.72
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.65
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.47
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.11
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.02
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.98
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.89
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 98.83
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 98.78
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 98.7
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 98.62
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 98.44
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 98.04
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 96.41
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 89.82
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Enteropeptidase (enterokinase light chain)
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=8.2e-48  Score=320.43  Aligned_cols=227  Identities=38%  Similarity=0.854  Sum_probs=192.8

Q ss_pred             eecCeeCCCCccceEEEEeeCCeEEeEEEEeeCCEEEeccCCcCCCCC--ceEEEEEeeeecccC-CCCceEEeeeEEEE
Q psy10841         46 VVGGKKAELGAWPWLIALYRDGFFHCGGVVLDESWVMTAAHCVDGFEK--HYFEVYAGMLRRFSF-SPTEQVRPVSRIVM  122 (286)
Q Consensus        46 i~~g~~a~~~~~Pw~v~i~~~~~~~C~GtLIs~~~VLTaAhC~~~~~~--~~~~v~~g~~~~~~~-~~~~~~~~v~~~~~  122 (286)
                      |+||++|..++|||+|.|+.++.++|+||||+++||||||||+.....  ....+..+....... ....+.+.+.++++
T Consensus         1 i~gG~~a~~~~~Pw~v~i~~~~~~~C~GtLIs~~~VLTaAhCv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   80 (235)
T d1ekbb_           1 IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVI   80 (235)
T ss_dssp             CBSCEECCTTSCTTEEEEEETTEEEEEEEECSSSEEEECHHHHTTCCSSGGGEEEEESCCBTTCCCCTTCEEEEEEEEEE
T ss_pred             CCCCEECCCCCCCcEEEEEECCCEEEEEEEEcCCEEEEChhhccCCCCCccceeeeecccccccccCcceeEeeeeeeee
Confidence            689999999999999999999999999999999999999999976443  355666665543322 34567889999999


Q ss_pred             CCCCCCCCCCCceEEEEecCccccCCceeeeecCCCCCCCCCCCceEEEEecccCCCCCCCccceeEeeeecc--cccc-
Q psy10841        123 HSMFKRAEMTNDLALLQLAAPLRYNRYVRPICLPDVTETPEPYSTCTAVGWGAVFEHGPDPDHMREVQVPILP--ACKH-  199 (286)
Q Consensus       123 hp~y~~~~~~~DiAllkL~~~i~~~~~v~picL~~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~--~c~~-  199 (286)
                      ||+|+.....+|||||||++++.|+..++|||||........+..+.++||+.....+.....++...+.+.+  .|.. 
T Consensus        81 hp~~~~~~~~~diAli~L~~~v~~~~~~~picLp~~~~~~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  160 (235)
T d1ekbb_          81 NPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQ  160 (235)
T ss_dssp             CTTCBTTTTBSCCEEEEESSCCCCCSSCCCCBCCCTTCCCCTTCEEEEEESSBSSTTSCBCSBCEEEEEEBCCHHHHHHH
T ss_pred             cccccccCccchhhhhhhcCceecCCceeeEECCCccccCCcceEEEEecccccccCCcccccceeeEEEEecHHHhccc
Confidence            9999999999999999999999999999999999876666778899999999887776667778888888776  2332 


Q ss_pred             --cccCCCCEEEEeeCCCCCCCCCCCCCCeeeeecCCCCCcEEEEEEEEecCCCCCCCCCeeEEeCCCcHHHHHhhhc
Q psy10841        200 --YEDRIADVICAGMPQGGRDTCQGDSGGPLLCPVPGSQGRWYVAGVVSHGEGCARPNEPGVYTRVSQFVPWLMSNSE  275 (286)
Q Consensus       200 --~~~~~~~~~C~~~~~~~~~~c~gdsGgPL~~~~~~~~~~~~lvGI~s~~~~c~~~~~p~v~t~v~~~~~WI~~~~~  275 (286)
                        .....+.++|+.......+.|.||+||||++..   +++|+|+||+|++..|+..+.|++|+||.+|++||+++|+
T Consensus       161 ~~~~~~~~~~~c~~~~~~~~~~c~gdsG~pl~~~~---~~~~~l~Gi~S~g~~~~~~~~p~v~t~v~~y~~WI~~~i~  235 (235)
T d1ekbb_         161 MPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQE---NNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH  235 (235)
T ss_dssp             CTTSCCCTTEEEECCTTCCCBCCTTCTTCEEEEEE---TTEEEEEEEEEECSSSSCTTCCEEEEEGGGTHHHHHTTCC
T ss_pred             ccccccCcccEEEEcCCCCcccccCCCCCccEEcc---CCEEEEEEEEEecCCCCCCCCCEEEEEHHHHHHHHHHhhC
Confidence              223567789998766667899999999999977   6799999999999999888899999999999999999874



>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure