Diaphorina citri psyllid: psy10859

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----

MLVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRGDFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS

cEEEEEEccccccccccccHHHHHHHccccccEEEEccccccHHHHHHHHHHcccEEEEccccccccccccCEEEEEccEEEEEECcccccccccHHHHHHHHHHccccccccCEEEEEccEEEEEECcccccccccHHHHHHHHHcccccEEEEcccccEEEEEEccEEEECccccccccccccccccccEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 29	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (igf2r and m6pr) from endosomes to the trans-Golgi network. Has low protein phosphatase activity.	very confident	Q7ZV68
Vacuolar protein sorting-associated protein 29	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro).	very confident	Q5R9Z1
Vacuolar protein sorting-associated protein 29	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro) (By similarity). Has no activity towards p-nitrophenylphosphate, p-nitrophenylphosphorylcholine or phosphatidylinositlphosphates (in vitro).	very confident	Q9QZ88

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005771 [CC]	multivesicular body	probable	GO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0010008 [CC]	endosome membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0004647 [MF]	phosphoserine phosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0001881 [BP]	receptor recycling	probable	GO:0044260, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0065007, GO:0008152, GO:0023051, GO:0008150, GO:0043112, GO:0050789
GO:0015031 [BP]	protein transport	probable	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.3	Phosphoserine phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z2W, chain A
Confidence level:very confident
Coverage over the Query: 1-71,114-224
View the alignment between query and template
View the model in PyMOL

Template: 2NXF, chain A
Confidence level:confident
Coverage over the Query: 1-209
View the alignment between query and template
View the model in PyMOL