Psyllid ID: psy10859

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----

MLVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRGDFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS

cEEEEEEcccccccccccHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccEEEEccccccccccccEEEEEEccEEEEEEEcccccccccHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccccHHHHHHHHHcccccEEEEcccccEEEEEEccEEEEEccccccccccccccccccEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEc

cEEEEEEcccccccHccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHcccEEEEEccccccccccccEEEEccccEEEEEcccEEccccccccccccccEEccccccccEEEEEccEEEEEEcccEEcccccHHHHHHHHHHcccEEEEEcccccEEEEEEccEEEEccccccccccccccccccEEEEEEEcccEEEEEEEEEEcccEEEEEEEEEcc

MLVLVLgdlhiphrtsglpakfkkllvpgriqhilctgnlvtKETFDYLKTLASdvhvvrgdfdegtsypekkvvtVGQFRIglchghdiipwgdPEALALLQRqldgtsypekkvvtVGQFRiglchghdiipwgdPEALALLQRQLDVDIlisghthkfeayehenkfyinpgsatgafnplepkvnpsfvlmdIQSSNVVTYVYQLIADEVTVERIDYKKS

MLVLVLgdlhiphrtsglpaKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVvrgdfdegtsypekkvVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIAdevtveridykks

*LVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRGDFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERID****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		224	2.2.26 [Sep-21-2011]
Q5R9Z1		182	Vacuolar protein sorting-	yes	N/A	0.812	1.0	0.660	3e-79
B2RZ78		182	Vacuolar protein sorting-	yes	N/A	0.812	1.0	0.660	4e-79
Q6DEU3		182	Vacuolar protein sorting-	yes	N/A	0.812	1.0	0.665	4e-79
Q6GP62		182	Vacuolar protein sorting-	N/A	N/A	0.812	1.0	0.665	4e-79
Q9QZ88		182	Vacuolar protein sorting-	yes	N/A	0.812	1.0	0.660	4e-79
Q7ZV68		182	Vacuolar protein sorting-	yes	N/A	0.812	1.0	0.656	1e-78
Q3T0M0		186	Vacuolar protein sorting-	yes	N/A	0.808	0.973	0.659	2e-78
Q9UBQ0		182	Vacuolar protein sorting-	yes	N/A	0.808	0.994	0.659	2e-78
Q5ZIL2		186	Vacuolar protein sorting-	yes	N/A	0.808	0.973	0.659	1e-77
Q54IF7		183	Vacuolar protein sorting-	yes	N/A	0.808	0.989	0.506	6e-62

>sp\|Q5R9Z1\|VPS29_PONAB Vacuolar protein sorting-associated protein 29 OS=Pongo abelii GN=VPS29 PE=2 SV=1	Back alignment and function desciption

 Score =  294 bits (753), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 164/224 (73%), Gaps = 42/224 (18%)

Query: 1   MLVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVR 60
           MLVLVLGDLHIPHR + LPAKFKKLLVPG+IQHILCTGNL TKE++DYLKTLA DVH+VR
Sbjct: 1   MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR 60

Query: 61  GDFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVG 120
           GDFDE  +Y                                          PE+KVVTVG
Sbjct: 61  GDFDENLNY------------------------------------------PEQKVVTVG 78

Query: 121 QFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGA 180
           QF+IGL HGH +IPWGD  +LALLQRQ DVDILISGHTHKFEA+EHENKFYINPGSATGA
Sbjct: 79  QFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGA 138

Query: 181 FNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS 224
           +N LE  + PSFVLMDIQ+S VVTYVYQLI D+V VERI+YKKS
Sbjct: 139 YNALEANIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 182

Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro).
Pongo abelii (taxid: 9601)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 3

>sp\|B2RZ78\|VPS29_RAT Vacuolar protein sorting-associated protein 29 OS=Rattus norvegicus GN=Vps29 PE=1 SV=2	Back alignment and function description

>sp\|Q6DEU3\|VPS29_XENTR Vacuolar protein sorting-associated protein 29 OS=Xenopus tropicalis GN=vps29 PE=2 SV=1	Back alignment and function description

>sp\|Q6GP62\|VPS29_XENLA Vacuolar protein sorting-associated protein 29 OS=Xenopus laevis GN=vps29 PE=2 SV=1	Back alignment and function description

>sp\|Q9QZ88\|VPS29_MOUSE Vacuolar protein sorting-associated protein 29 OS=Mus musculus GN=Vps29 PE=1 SV=1	Back alignment and function description

>sp\|Q7ZV68\|VPS29_DANRE Vacuolar protein sorting-associated protein 29 OS=Danio rerio GN=vps29 PE=2 SV=1	Back alignment and function description

>sp\|Q3T0M0\|VPS29_BOVIN Vacuolar protein sorting-associated protein 29 OS=Bos taurus GN=VPS29 PE=2 SV=1	Back alignment and function description

>sp\|Q9UBQ0\|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 OS=Homo sapiens GN=VPS29 PE=1 SV=1	Back alignment and function description

>sp\|Q5ZIL2\|VPS29_CHICK Vacuolar protein sorting-associated protein 29 OS=Gallus gallus GN=VPS29 PE=2 SV=1	Back alignment and function description

>sp\|Q54IF7\|VPS29_DICDI Vacuolar protein sorting-associated protein 29 OS=Dictyostelium discoideum GN=vps29 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		224
383861650		197	PREDICTED: vacuolar protein sorting-asso	0.808	0.918	0.695	1e-81
340729114		182	PREDICTED: vacuolar protein sorting-asso	0.812	1.0	0.691	1e-81
427786973		182	Putative vacuolar protein [Rhipicephalus	0.812	1.0	0.687	1e-81
345479785		182	PREDICTED: vacuolar protein sorting-asso	0.812	1.0	0.691	1e-81
332020652		209	Vacuolar protein sorting-associated prot	0.808	0.866	0.695	2e-81
350401456		186	PREDICTED: vacuolar protein sorting-asso	0.808	0.973	0.690	4e-81
346469829		182	hypothetical protein [Amblyomma maculatu	0.812	1.0	0.683	6e-81
240960469		182	membrane coat complex retromer, subunit	0.812	1.0	0.674	6e-80
58383585		182	AGAP002338-PA [Anopheles gambiae str. PE	0.812	1.0	0.669	7e-80
332375811		182	unknown [Dendroctonus ponderosae]	0.812	1.0	0.669	2e-79

>gi\|383861650\|ref\|XP_003706298.1\| PREDICTED: vacuolar protein sorting-associated protein 29-like [Megachile rotundata]	Back alignment and taxonomy information

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 155/223 (69%), Positives = 168/223 (75%), Gaps = 42/223 (18%)

Query: 2   LVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRG 61
           LVLVLGDLHIPHR S LP+KFKKLLVPGRIQHILCTGNL TKE++DYLKTLASDVHVVRG
Sbjct: 17  LVLVLGDLHIPHRCSSLPSKFKKLLVPGRIQHILCTGNLCTKESYDYLKTLASDVHVVRG 76

Query: 62  DFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQ 121
           DFDE  +Y                                          PE+KVVTVGQ
Sbjct: 77  DFDENLNY------------------------------------------PEQKVVTVGQ 94

Query: 122 FRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAF 181
           FRIGL HGH ++PWGDPE+LAL+QRQLDVDILISGHTHKFEAYEHENKFYINPGSATGA+
Sbjct: 95  FRIGLSHGHQVVPWGDPESLALIQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAY 154

Query: 182 NPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS 224
           NPL+  V PSFVLMDIQSS VVTYVYQL+ DEV VERI+YKKS
Sbjct: 155 NPLDTSVIPSFVLMDIQSSTVVTYVYQLVGDEVKVERIEYKKS 197

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|340729114\|ref\|XP_003402853.1\| PREDICTED: vacuolar protein sorting-associated protein 29-like [Bombus terrestris] gi\|380013829\|ref\|XP_003690948.1\| PREDICTED: vacuolar protein sorting-associated protein 29-like [Apis florea]	Back alignment and taxonomy information

>gi\|427786973\|gb\|JAA58938.1\| Putative vacuolar protein [Rhipicephalus pulchellus]	Back alignment and taxonomy information

>gi\|345479785\|ref\|XP_001604061.2\| PREDICTED: vacuolar protein sorting-associated protein 29-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|332020652\|gb\|EGI61058.1\| Vacuolar protein sorting-associated protein 29 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|350401456\|ref\|XP_003486158.1\| PREDICTED: vacuolar protein sorting-associated protein 29-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|346469829\|gb\|AEO34759.1\| hypothetical protein [Amblyomma maculatum]	Back alignment and taxonomy information

>gi\|240960469\|ref\|XP_002400550.1\| membrane coat complex retromer, subunit VPS29/PEP11, putative [Ixodes scapularis] gi\|215490693\|gb\|EEC00336.1\| membrane coat complex retromer, subunit VPS29/PEP11, putative [Ixodes scapularis] gi\|442760111\|gb\|JAA72214.1\| Putative membrane coat complex retromer subunit [Ixodes ricinus]	Back alignment and taxonomy information

>gi\|58383585\|ref\|XP_312630.2\| AGAP002338-PA [Anopheles gambiae str. PEST] gi\|55242454\|gb\|EAA08218.2\| AGAP002338-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|332375811\|gb\|AEE63046.1\| unknown [Dendroctonus ponderosae]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		224
FB\|FBgn0031310		182	CG4764 [Drosophila melanogaste	0.522	0.642	0.811	6.7e-49
MGI\|MGI:1928344		182	Vps29 "vacuolar protein sortin	0.526	0.648	0.779	2e-47
RGD\|1308332		182	Vps29 "vacuolar protein sortin	0.526	0.648	0.779	2e-47
UNIPROTKB\|G3X6P5		185	VPS29 "Vacuolar protein sortin	0.526	0.637	0.779	2e-47
UNIPROTKB\|Q3T0M0		186	VPS29 "Vacuolar protein sortin	0.526	0.634	0.779	2e-47
UNIPROTKB\|F1RNN0		186	VPS29 "Uncharacterized protein	0.526	0.634	0.779	2e-47
UNIPROTKB\|Q9UBQ0		182	VPS29 "Vacuolar protein sortin	0.522	0.642	0.777	5.4e-47
UNIPROTKB\|E2R8A2		180	VPS29 "Uncharacterized protein	0.522	0.65	0.777	5.4e-47
UNIPROTKB\|F8VXU5		214	VPS29 "Vacuolar protein sortin	0.522	0.546	0.777	5.4e-47
UNIPROTKB\|H3BLV8		199	VPS29 "Vacuolar protein sortin	0.522	0.587	0.777	5.4e-47

FB\|FBgn0031310 CG4764 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 510 (184.6 bits), Expect = 6.7e-49, P = 6.7e-49
 Identities = 95/117 (81%), Positives = 106/117 (90%)

Query:   107 DGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEH 166
             +  +YPE+KVVTVGQFRIGLCHGH ++P GDPEALAL+QRQLDVDILI+GHT+KFEAYEH
Sbjct:    65 ENLTYPEQKVVTVGQFRIGLCHGHQVVPRGDPEALALIQRQLDVDILITGHTYKFEAYEH 124

Query:   167 ENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKK 223
              NKFYINPGSATGAFNPL+  V PSFVLMDIQS+ VVTYVYQLI DEV VERI+YKK
Sbjct:   125 GNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVYQLIGDEVKVERIEYKK 181

GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA

MGI\|MGI:1928344 Vps29 "vacuolar protein sorting 29 (S. pombe)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1308332 Vps29 "vacuolar protein sorting 29 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|G3X6P5 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3T0M0 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RNN0 VPS29 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UBQ0 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R8A2 VPS29 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F8VXU5 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|H3BLV8 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q7ZV68	VPS29_DANRE	3, ., 1, ., 3, ., 3	0.6562	0.8125	1.0	yes	N/A
Q5R9Z1	VPS29_PONAB	3, ., 1, ., 3, ., 3	0.6607	0.8125	1.0	yes	N/A
Q9QZ88	VPS29_MOUSE	3, ., 1, ., 3, ., 3	0.6607	0.8125	1.0	yes	N/A
B2RZ78	VPS29_RAT	3, ., 1, ., 3, ., 3	0.6607	0.8125	1.0	yes	N/A
Q3T0M0	VPS29_BOVIN	3, ., 1, ., 3, ., 3	0.6591	0.8080	0.9731	yes	N/A
Q9UTI5	VPS29_SCHPO	No assigned EC number	0.3920	0.8080	0.9679	yes	N/A
Q9STT2	VPS29_ARATH	No assigned EC number	0.5112	0.8080	0.9526	yes	N/A
Q54IF7	VPS29_DICDI	3, ., 1, ., 3, ., 3	0.5067	0.8080	0.9890	yes	N/A
Q6DEU3	VPS29_XENTR	3, ., 1, ., 3, ., 3	0.6651	0.8125	1.0	yes	N/A
Q9UBQ0	VPS29_HUMAN	3, ., 1, ., 3, ., 3	0.6591	0.8080	0.9945	yes	N/A
Q5ZIL2	VPS29_CHICK	3, ., 1, ., 3, ., 3	0.6591	0.8080	0.9731	yes	N/A
Q6GP62	VPS29_XENLA	3, ., 1, ., 3, ., 3	0.6651	0.8125	1.0	N/A	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3	0.976
3rd Layer	3.1.3.3	0.991

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		224
cd07394		178	cd07394, MPP_Vps29, Homo sapiens Vps29 and related	1e-116
COG0622		172	COG0622, COG0622, Predicted phosphoesterase [Gener	2e-31
TIGR00040		158	TIGR00040, yfcE, phosphoesterase, MJ0936 family	8e-28
pfam12850		146	pfam12850, Metallophos_2, Calcineurin-like phospho	6e-25
cd00841		155	cd00841, MPP_YfcE, Escherichia coli YfcE and relat	5e-19
pfam00149		185	pfam00149, Metallophos, Calcineurin-like phosphoes	3e-10
PRK09453		182	PRK09453, PRK09453, phosphodiesterase; Provisional	8e-07
cd07398		217	cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH	6e-05

>gnl\|CDD\|163637 cd07394, MPP_Vps29, Homo sapiens Vps29 and related proteins, metallophosphatase domain	Back alignment and domain information

 Score =  329 bits (845), Expect = e-116
 Identities = 140/220 (63%), Positives = 160/220 (72%), Gaps = 42/220 (19%)

Query: 2   LVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRG 61
           LVLV+GDLHIPHR S LPAKFKKLLVPG+IQH+LCTGNL +KET+DYLKT+A DVH+VRG
Sbjct: 1   LVLVIGDLHIPHRASDLPAKFKKLLVPGKIQHVLCTGNLCSKETYDYLKTIAPDVHIVRG 60

Query: 62  DFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQ 121
           DFDE  +YPE KV+TVGQF+IGL HGH ++PWGDP++LA LQRQLD              
Sbjct: 61  DFDENLNYPETKVITVGQFKIGLIHGHQVVPWGDPDSLAALQRQLD-------------- 106

Query: 122 FRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAF 181
                                       VDILISGHTHKFEA+EHE KF+INPGSATGAF
Sbjct: 107 ----------------------------VDILISGHTHKFEAFEHEGKFFINPGSATGAF 138

Query: 182 NPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDY 221
           +PL+P V PSFVLMDIQ S VVTYVYQLI  EV VE+I+Y
Sbjct: 139 SPLDPNVIPSFVLMDIQGSKVVTYVYQLIDGEVKVEKIEY 178

Vps29 (vacuolar sorting protein 29), also known as vacuolar membrane protein Pep11, is a subunit of the retromer complex which is responsible for the retrieval of mannose-6-phosphate receptors (MPRs) from the endosomes for retrograde transport back to the Golgi. Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer complex assembly as well as a phosphatase with specificity for the cytoplasmic tail of the MPR. The retromer includes the following 5 subunits: Vps35, Vps26, Vps29, and a dimer of the sorting nexins Vps5 (Snx1), and Vps17 (Snx2). Vps29 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 178

>gnl\|CDD\|223695 COG0622, COG0622, Predicted phosphoesterase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|232794 TIGR00040, yfcE, phosphoesterase, MJ0936 family	Back alignment and domain information

>gnl\|CDD\|221807 pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain	Back alignment and domain information

>gnl\|CDD\|163617 cd00841, MPP_YfcE, Escherichia coli YfcE and related proteins, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase	Back alignment and domain information

>gnl\|CDD\|181869 PRK09453, PRK09453, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|163641 cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		224
cd07394		178	MPP_Vps29 Homo sapiens Vps29 and related proteins,	100.0
KOG3325\|consensus		183		99.97
TIGR00040		158	yfcE phosphoesterase, MJ0936 family. Members of th	99.96
COG0622		172	Predicted phosphoesterase [General function predic	99.96
PRK09453		182	phosphodiesterase; Provisional	99.95
PF12850		156	Metallophos_2: Calcineurin-like phosphoesterase su	99.94
cd00841		155	MPP_YfcE Escherichia coli YfcE and related protein	99.94
PRK11148		275	cyclic 3',5'-adenosine monophosphate phosphodieste	99.93
cd07388		224	MPP_Tt1561 Thermus thermophilus Tt1561 and related	99.93
cd07402		240	MPP_GpdQ Enterobacter aerogenes GpdQ and related p	99.92
cd07395		262	MPP_CSTP1 Homo sapiens CSTP1 and related proteins,	99.92
COG2129		226	Predicted phosphoesterases, related to the Icc pro	99.9
cd07392		188	MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel	99.89
cd07396		267	MPP_Nbla03831 Homo sapiens Nbla03831 and related p	99.89
TIGR00583		405	mre11 DNA repair protein (mre11). All proteins in	99.88
PRK05340		241	UDP-2,3-diacylglucosamine hydrolase; Provisional	99.87
cd00839		294	MPP_PAPs purple acid phosphatases of the metalloph	99.86
cd07393		232	MPP_DR1119 Deinococcus radiodurans DR1119 and rela	99.85
cd07379		135	MPP_239FB Homo sapiens 239FB and related proteins,	99.84
COG2908		237	Uncharacterized protein conserved in bacteria [Fun	99.84
cd07400		144	MPP_YydB Bacillus subtilis YydB and related protei	99.84
cd07378		277	MPP_ACP5 Homo sapiens acid phosphatase 5 and relat	99.84
PHA02546		340	47 endonuclease subunit; Provisional	99.84
TIGR01854		231	lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase.	99.83
TIGR03729		239	acc_ester putative phosphoesterase. Members of thi	99.82
cd07383		199	MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase	99.82
PF14582		255	Metallophos_3: Metallophosphoesterase, calcineurin	99.82
cd00840		223	MPP_Mre11_N Mre11 nuclease, N-terminal metallophos	99.81
cd07397		238	MPP_DevT Myxococcus xanthus DevT and related prote	99.79
cd07399		214	MPP_YvnB Bacillus subtilis YvnB and related protei	99.79
COG0420		390	SbcD DNA repair exonuclease [DNA replication, reco	99.78
cd07404		166	MPP_MS158 Microscilla MS158 and related proteins,	99.78
PRK11340		271	phosphodiesterase YaeI; Provisional	99.78
cd07424		207	MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do	99.77
cd07385		223	MPP_YkuE_C Bacillus subtilis YkuE and related prot	99.77
cd07398		217	MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat	99.77
PRK10966		407	exonuclease subunit SbcD; Provisional	99.77
PRK09968		218	serine/threonine-specific protein phosphatase 2; P	99.75
PLN02533		427	probable purple acid phosphatase	99.74
cd07401		256	MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal	99.74
PRK11439		218	pphA serine/threonine protein phosphatase 1; Provi	99.73
cd07403		129	MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel	99.72
PF00149		200	Metallophos: Calcineurin-like phosphoesterase; Int	99.71
cd07423		234	MPP_PrpE Bacillus subtilis PrpE and related protei	99.7
COG1409		301	Icc Predicted phosphohydrolases [General function	99.7
TIGR00619		253	sbcd exonuclease SbcD. This family is based on the	99.66
COG1768		230	Predicted phosphohydrolase [General function predi	99.65
PTZ00422		394	glideosome-associated protein 50; Provisional	99.6
cd07390		168	MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro	99.6
PRK04036		504	DNA polymerase II small subunit; Validated	99.58
cd07386		243	MPP_DNA_pol_II_small_archeal_C archeal DNA polymer	99.55
cd08165		156	MPP_MPPE1 human MPPE1 and related proteins, metall	99.53
cd00838		131	MPP_superfamily metallophosphatase superfamily, me	99.52
COG1408		284	Predicted phosphohydrolases [General function pred	99.52
KOG1432\|consensus		379		99.49
cd07425		208	MPP_Shelphs Shewanella-like phosphatases, metallop	99.47
PRK13625		245	bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision	99.46
TIGR03767		496	P_acnes_RR metallophosphoesterase, PPA1498 family.	99.45
cd08163		257	MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related	99.43
KOG2310\|consensus		646		99.41
cd07391		172	MPP_PF1019 Pyrococcus furiosus PF1019 and related	99.41
COG4186		186	Predicted phosphoesterase or phosphohydrolase [Gen	99.39
cd00845		252	MPP_UshA_N_like Escherichia coli UshA-like family,	99.38
cd07384		171	MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re	99.38
TIGR00024		225	SbcD_rel_arch putative phosphoesterase, SbcD/Mre11	99.37
cd07410		277	MPP_CpdB_N Escherichia coli CpdB and related prote	99.36
cd00842		296	MPP_ASMase acid sphingomyelinase and related prote	99.35
cd07406		257	MPP_CG11883_N Drosophila melanogaster CG11883 and	99.31
cd07408		257	MPP_SA0022_N Staphylococcus aureus SA0022 and rela	99.29
COG1311		481	HYS2 Archaeal DNA polymerase II, small subunit/DNA	99.26
cd00844		262	MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t	99.26
KOG1378\|consensus		452		99.23
PRK00166		275	apaH diadenosine tetraphosphatase; Reviewed	99.21
KOG2679\|consensus		336		99.19
cd07421		304	MPP_Rhilphs Rhilph phosphatases, metallophosphatas	99.18
cd00144		225	MPP_PPP_family phosphoprotein phosphatases of the	99.17
cd07411		264	MPP_SoxB_N Thermus thermophilus SoxB and related p	99.14
cd08166		195	MPP_Cdc1_like_1 uncharacterized subgroup related t	99.14
cd07405		285	MPP_UshA_N Escherichia coli UshA and related prote	99.12
cd07412		288	MPP_YhcR_N Bacillus subtilis YhcR endonuclease and	99.09
PHA02239		235	putative protein phosphatase	99.07
TIGR00668		279	apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric	99.04
TIGR03768		492	RPA4764 metallophosphoesterase, RPA4764 family. Th	99.04
cd07387		257	MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2	98.99
cd07422		257	MPP_ApaH Escherichia coli ApaH and related protein	98.98
PRK09419		1163	bifunctional 2',3'-cyclic nucleotide 2'-phosphodie	98.97
cd07407		282	MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and	98.94
cd07409		281	MPP_CD73_N CD73 ecto-5'-nucleotidase and related p	98.93
COG1407		235	Predicted ICC-like phosphoesterases [General funct	98.92
cd08164		193	MPP_Ted1 Saccharomyces cerevisiae Ted1 and related	98.9
smart00156		271	PP2Ac Protein phosphatase 2A homologues, catalytic	98.87
PRK09558		551	ushA bifunctional UDP-sugar hydrolase/5'-nucleotid	98.82
cd07382		255	MPP_DR1281 Deinococcus radiodurans DR1281 and rela	98.8
cd07413		222	MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat	98.79
PRK09419		1163	bifunctional 2',3'-cyclic nucleotide 2'-phosphodie	98.79
TIGR00282		266	metallophosphoesterase, MG_246/BB_0505 family. A m	98.76
PRK11907		814	bifunctional 2',3'-cyclic nucleotide 2'-phosphodie	98.73
PRK09418		780	bifunctional 2',3'-cyclic nucleotide 2'-phosphodie	98.69
COG0737		517	UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras	98.67
TIGR01390		626	CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod	98.64
cd07380		150	MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re	98.62
cd07416		305	MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca	98.61
cd07417		316	MPP_PP5_C PP5, C-terminal metallophosphatase domai	98.6
cd07414		293	MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme	98.6
PTZ00480		320	serine/threonine-protein phosphatase; Provisional	98.59
cd08162		313	MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA	98.56
PRK09420		649	cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp	98.55
PTZ00244		294	serine/threonine-protein phosphatase PP1; Provisio	98.54
TIGR01530		550	nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi	98.5
cd07415		285	MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein	98.5
KOG3947\|consensus		305		98.45
cd07419		311	MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a	98.44
PTZ00239		303	serine/threonine protein phosphatase 2A; Provision	98.32
KOG2863\|consensus		456		98.29
cd07420		321	MPP_RdgC Drosophila melanogaster RdgC and related	98.22
KOG3770\|consensus		577		98.05
cd07418		377	MPP_PP7 PP7, metallophosphatase domain. PP7 is a p	98.05
COG1692		266	Calcineurin-like phosphoesterase [General function	97.96
KOG3662\|consensus		410		97.91
PHA03008		234	hypothetical protein; Provisional	97.58
PF04042		209	DNA_pol_E_B: DNA polymerase alpha/epsilon subunit	97.39
smart00854		239	PGA_cap Bacterial capsule synthesis protein PGA_ca	97.26
cd07381		239	MPP_CapA CapA and related proteins, metallophospha	97.18
PF13277		253	YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C.	97.13
KOG0374\|consensus		331		97.1
PF09587		250	PGA_cap: Bacterial capsule synthesis protein PGA_c	97.06
KOG0373\|consensus		306		96.04
KOG4419\|consensus		602		96.04
KOG0371\|consensus		319		95.81
KOG0372\|consensus		303		95.69
KOG2476\|consensus		528		94.43
KOG3818\|consensus		525		94.31
PTZ00235		291	DNA polymerase epsilon subunit B; Provisional	93.78
KOG1625\|consensus		600		91.77
COG5214		581	POL12 DNA polymerase alpha-primase complex, polyme	90.52
KOG0375\|consensus		517		90.47
PF06874		640	FBPase_2: Firmicute fructose-1,6-bisphosphatase; I	90.01
PF09423		453	PhoD: PhoD-like phosphatase; InterPro: IPR018946 T	89.83
PRK02228		100	V-type ATP synthase subunit F; Provisional	87.75
KOG0376\|consensus		476		86.9
COG3855		648	Fbp Uncharacterized protein conserved in bacteria	80.17

>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain	Back alignment and domain information

Probab=100.00  E-value=2.1e-33  Score=209.98  Aligned_cols=178  Identities=79%  Similarity=1.325  Sum_probs=144.3

Q ss_pred             eEEEEeeccCCCCCCCChHHHHHhhcCCCccEEEEcCCCCChHHHHHHHhcCCcEEEecCCCCCCCCCCcceEEEeCCEE
Q psy10859          2 LVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRGDFDEGTSYPEKKVVTVGQFR   81 (224)
Q Consensus         2 ki~~isDiH~~~~~~~~~~~l~~~~~~~~~D~vi~~GDl~~~~~~~~l~~l~~~v~~v~GNHD~~~~~~~~~~~~~~~~~   81 (224)
                      +|+++||+|++.+...+++.+.++++..++|.++++||+++.++++.+++++.++++|.||||....+|..         
T Consensus         1 ~i~viSDtHl~~~~~~~~~~~~~~~~~~~~d~iih~GDi~~~~~~~~l~~~~~~~~~V~GN~D~~~~lp~~---------   71 (178)
T cd07394           1 LVLVIGDLHIPHRASDLPAKFKKLLVPGKIQHVLCTGNLCSKETYDYLKTIAPDVHIVRGDFDENLNYPET---------   71 (178)
T ss_pred             CEEEEEecCCCCCchhhHHHHHHHhccCCCCEEEECCCCCCHHHHHHHHhhCCceEEEECCCCccccCCCc---------
Confidence            58999999976554455667888877678999999999999999999988766899999999985333333         


Q ss_pred             EEeeecCcccCCCCHHHHHHHHHhhcCCCCCCceeeeeCCeEEEeeccCCCCCCCCHHHHHHHhhhcCCcEEEECCCCCC
Q psy10859         82 IGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKF  161 (224)
Q Consensus        82 ~~~~~g~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~i~~~H~~~~~~~~~~~~l~~~~~~~~~~~vi~GH~H~~  161 (224)
                                                       .....++.+++++||++..++...+.+..+++..+++++++||||.+
T Consensus        72 ---------------------------------~~~~~~g~~i~l~HG~~~~~~~~~~~~~~~~~~~~~dvii~GHTH~p  118 (178)
T cd07394          72 ---------------------------------KVITVGQFKIGLIHGHQVVPWGDPDSLAALQRQLDVDILISGHTHKF  118 (178)
T ss_pred             ---------------------------------EEEEECCEEEEEEECCcCCCCCCHHHHHHHHHhcCCCEEEECCCCcc
Confidence                                             33445566777777776655555666666667788999999999999


Q ss_pred             ceEEEcCEEEEcCCCCCCCCCCCCCCCCCeEEEEEEeCCeEEEEEEEeecCceeEEEEee
Q psy10859        162 EAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDY  221 (224)
Q Consensus       162 ~~~~~~~~~~in~Gs~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~  221 (224)
                      .....++++++||||++.++.|.+....++|++++++++.+.++++++.+++++++.|++
T Consensus       119 ~~~~~~g~~viNPGSv~~~~~~~~~~~~~syail~~~~~~~~~~~~~l~~~~~~~~~~~~  178 (178)
T cd07394         119 EAFEHEGKFFINPGSATGAFSPLDPNVIPSFVLMDIQGSKVVTYVYQLIDGEVKVEKIEY  178 (178)
T ss_pred             eEEEECCEEEEECCCCCCCCCCCCCCCCCeEEEEEecCCeEEEEEEEEECCcEEEEEecC
Confidence            999999999999999997554545556789999999999999999999999999999975

>KOG3325\|consensus	Back alignment and domain information

>TIGR00040 yfcE phosphoesterase, MJ0936 family	Back alignment and domain information

>COG0622 Predicted phosphoesterase [General function prediction only]	Back alignment and domain information

>PRK09453 phosphodiesterase; Provisional	Back alignment and domain information

>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily []	Back alignment and domain information

>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional	Back alignment and domain information

>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain	Back alignment and domain information

>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only]	Back alignment and domain information

>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR00583 mre11 DNA repair protein (mre11)	Back alignment and domain information

>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional	Back alignment and domain information

>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain	Back alignment and domain information

>COG2908 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain	Back alignment and domain information

>PHA02546 47 endonuclease subunit; Provisional	Back alignment and domain information

>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase	Back alignment and domain information

>TIGR03729 acc_ester putative phosphoesterase	Back alignment and domain information

>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain	Back alignment and domain information

>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A	Back alignment and domain information

>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain	Back alignment and domain information

>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK11340 phosphodiesterase YaeI; Provisional	Back alignment and domain information

>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain	Back alignment and domain information

>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK10966 exonuclease subunit SbcD; Provisional	Back alignment and domain information

>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional	Back alignment and domain information

>PLN02533 probable purple acid phosphatase	Back alignment and domain information

>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain	Back alignment and domain information

>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional	Back alignment and domain information

>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain	Back alignment and domain information

>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11	Back alignment and domain information

>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain	Back alignment and domain information

>COG1409 Icc Predicted phosphohydrolases [General function prediction only]	Back alignment and domain information

>TIGR00619 sbcd exonuclease SbcD	Back alignment and domain information

>COG1768 Predicted phosphohydrolase [General function prediction only]	Back alignment and domain information

>PTZ00422 glideosome-associated protein 50; Provisional	Back alignment and domain information

>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK04036 DNA polymerase II small subunit; Validated	Back alignment and domain information

>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain	Back alignment and domain information

>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>COG1408 Predicted phosphohydrolases [General function prediction only]	Back alignment and domain information

>KOG1432\|consensus	Back alignment and domain information

>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain	Back alignment and domain information

>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional	Back alignment and domain information

>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family	Back alignment and domain information

>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG2310\|consensus	Back alignment and domain information

>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain	Back alignment and domain information

>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only]	Back alignment and domain information

>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related	Back alignment and domain information

>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain	Back alignment and domain information

>KOG1378\|consensus	Back alignment and domain information

>PRK00166 apaH diadenosine tetraphosphatase; Reviewed	Back alignment and domain information

>KOG2679\|consensus	Back alignment and domain information

>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain	Back alignment and domain information

>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain	Back alignment and domain information

>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>PHA02239 putative protein phosphatase	Back alignment and domain information

>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	Back alignment and domain information

>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family	Back alignment and domain information

>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain	Back alignment and domain information

>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed	Back alignment and domain information

>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>COG1407 Predicted ICC-like phosphoesterases [General function prediction only]	Back alignment and domain information

>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain	Back alignment and domain information

>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain	Back alignment and domain information

>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed	Back alignment and domain information

>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed	Back alignment and domain information

>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family	Back alignment and domain information

>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed	Back alignment and domain information

>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed	Back alignment and domain information

>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase	Back alignment and domain information

>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07416 MPP_PP2B PP2B, metallophosphatase domain	Back alignment and domain information

>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain	Back alignment and domain information

>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain	Back alignment and domain information

>PTZ00480 serine/threonine-protein phosphatase; Provisional	Back alignment and domain information

>cd08162 MPP_PhoA_N Synechococcus sp	Back alignment and domain information

>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed	Back alignment and domain information

>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional	Back alignment and domain information

>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN	Back alignment and domain information

>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain	Back alignment and domain information

>KOG3947\|consensus	Back alignment and domain information

>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>PTZ00239 serine/threonine protein phosphatase 2A; Provisional	Back alignment and domain information

>KOG2863\|consensus	Back alignment and domain information

>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG3770\|consensus	Back alignment and domain information

>cd07418 MPP_PP7 PP7, metallophosphatase domain	Back alignment and domain information

>COG1692 Calcineurin-like phosphoesterase [General function prediction only]	Back alignment and domain information

>KOG3662\|consensus	Back alignment and domain information

>PHA03008 hypothetical protein; Provisional	Back alignment and domain information

>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast	Back alignment and domain information

>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap	Back alignment and domain information

>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain	Back alignment and domain information

>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C	Back alignment and domain information

>KOG0374\|consensus	Back alignment and domain information

>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria	Back alignment and domain information

>KOG0373\|consensus	Back alignment and domain information

>KOG4419\|consensus	Back alignment and domain information

>KOG0371\|consensus	Back alignment and domain information

>KOG0372\|consensus	Back alignment and domain information

>KOG2476\|consensus	Back alignment and domain information

>KOG3818\|consensus	Back alignment and domain information

>PTZ00235 DNA polymerase epsilon subunit B; Provisional	Back alignment and domain information

>KOG1625\|consensus	Back alignment and domain information

>COG5214 POL12 DNA polymerase alpha-primase complex, polymerase-associated subunit B [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0375\|consensus	Back alignment and domain information

>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate []	Back alignment and domain information

>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B	Back alignment and domain information

>PRK02228 V-type ATP synthase subunit F; Provisional	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		224
1z2w_A		192	Crystal Structure Of Mouse Vps29 Complexed With Mn2		7e-80
1w24_A		182	Crystal Structure Of Human Vps29 Length = 182		2e-79
2r17_A		183	Functional Architecture Of The Retromer Cargo-Recog		2e-75
2a22_A		215	Structure Of Vacuolar Protein Sorting 29 From Crypt		7e-43

>pdb|1Z2W|A Chain A, Crystal Structure Of Mouse Vps29 Complexed With Mn2+ Length = 192

Back alignment and structure

Iteration: 1

Score = 293 bits (749), Expect = 7e-80, Method: Compositional matrix adjust. Identities = 148/224 (66%), Positives = 164/224 (73%), Gaps = 42/224 (18%) Query: 1 MLVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVR 60 MLVLVLGDLHIPHR + LPAKFKKLLVPG+IQHILCTGNL TKE++DYLKTLA DVH+VR Sbjct: 11 MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR 70 Query: 61 GDFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVG 120 GDFDE +Y PE+KVVTVG Sbjct: 71 GDFDENLNY------------------------------------------PEQKVVTVG 88 Query: 121 QFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGA 180 QF+IGL HGH +IPWGD +LALLQRQ DVDILISGHTHKFEA+EHENKFYINPGSATGA Sbjct: 89 QFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGA 148 Query: 181 FNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS 224 +N LE + PSFVLMDIQ+S VVTYVYQLI D+V VERI+YKKS Sbjct: 149 YNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS 192

PyMOL of 1z2w

>pdb|1W24|A Chain A, Crystal Structure Of Human Vps29 Length = 182

Back alignment and structure

>pdb|2R17|A Chain A, Functional Architecture Of The Retromer Cargo-Recognition Complex Length = 183

Back alignment and structure

>pdb|2A22|A Chain A, Structure Of Vacuolar Protein Sorting 29 From Cryptosporidium Parvum Length = 215

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		224
2a22_A		215	Vacuolar protein sorting 29; alpha-beta-BETA-alpha	3e-73
1z2w_A		192	Vacuolar protein sorting 29; VPS29, retromer, phos	3e-68
2kkn_A		178	Uncharacterized protein; protein phosphatase 2A ho	4e-47
3ck2_A		176	Conserved uncharacterized protein (predicted phosp	1e-29
1s3l_A		190	Hypothetical protein MJ0936; phosphodiesterase, nu	3e-22
1su1_A		208	Hypothetical protein YFCE; structural genomics, ph	2e-16
3qfm_A		270	SAPH, putative uncharacterized protein; sandwich f	7e-10
1nnw_A		252	Hypothetical protein; structural genomics, PSI, pr	2e-08
3rqz_A		246	Metallophosphoesterase; PSI-biology, midwest cente	2e-04
2nxf_A		322	Putative dimetal phosphatase; dinuclear metal cent	3e-04

>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Length = 215	Back alignment and structure

 Score =  220 bits (562), Expect = 3e-73
 Identities = 82/222 (36%), Positives = 123/222 (55%), Gaps = 33/222 (14%)

Query: 2   LVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRG 61
           LVL++GDL IP+    LP+ F++LL   +I ++LCTGN+ ++E  + LK +  +V++V G
Sbjct: 27  LVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSG 86

Query: 62  DFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQ 121
           D D     P+ +                                     +PE  VV +G+
Sbjct: 87  DLDSAIFNPDPES---------------------------------NGVFPEYVVVQIGE 113

Query: 122 FRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAF 181
           F+IGL HG+ ++PW DP +L   QR+LD DIL++GHTHK   +E   K ++NPG+ATGAF
Sbjct: 114 FKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAF 173

Query: 182 NPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKK 223
           + L P   PSF+LM +Q + VV YVY L   +  V   ++ K
Sbjct: 174 SALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK 215

PyMOL of 2a22

>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Length = 192	Back alignment and structure

>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Length = 178	Back alignment and structure

>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Length = 176	Back alignment and structure

>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Length = 190	Back alignment and structure

>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Length = 208	Back alignment and structure

>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270	Back alignment and structure

>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252	Back alignment and structure

>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246	Back alignment and structure

>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Length = 322	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		224
1z2w_A		192	Vacuolar protein sorting 29; VPS29, retromer, phos	100.0
2a22_A		215	Vacuolar protein sorting 29; alpha-beta-BETA-alpha	100.0
3ck2_A		176	Conserved uncharacterized protein (predicted phosp	99.96
2kkn_A		178	Uncharacterized protein; protein phosphatase 2A ho	99.96
3ib7_A		330	ICC protein; metallophosphoesterase, alpha-beta fo	99.95
3qfm_A		270	SAPH, putative uncharacterized protein; sandwich f	99.95
1s3l_A		190	Hypothetical protein MJ0936; phosphodiesterase, nu	99.94
3d03_A		274	Phosphohydrolase; glycerophosphodiesterase, metall	99.94
1nnw_A		252	Hypothetical protein; structural genomics, PSI, pr	99.94
1uf3_A		228	Hypothetical protein TT1561; metallo-dependent pho	99.93
2yvt_A		260	Hypothetical protein AQ_1956; structural genomics,	99.93
3rqz_A		246	Metallophosphoesterase; PSI-biology, midwest cente	99.93
1su1_A		208	Hypothetical protein YFCE; structural genomics, ph	99.92
2nxf_A		322	Putative dimetal phosphatase; dinuclear metal cent	99.91
2xmo_A		443	LMO2642 protein; phosphodiesterase, hydrolase; 1.7	99.9
4fbk_A		472	DNA repair and telomere maintenance protein NBS1,	99.89
3av0_A		386	DNA double-strand break repair protein MRE11; DNA	99.89
4fbw_A		417	DNA repair protein RAD32; DNA double-strand break	99.89
3t1i_A		431	Double-strand break repair protein MRE11A; DNA rep	99.89
1ute_A		313	Protein (II purple acid phosphatase); tartrate res	99.88
1xm7_A		195	Hypothetical protein AQ_1665; structural genomics,	99.88
2q8u_A		336	Exonuclease, putative; structural genomics, joint	99.87
3rl5_A		296	Metallophosphoesterase mpped2; alpha-beta fold, me	99.87
3tho_B		379	Exonuclease, putative; adenosine triphosphate, bac	99.85
1ii7_A		333	MRE11 nuclease; RAD50, DNA double-strand break rep	99.83
3tgh_A		342	Glideosome-associated protein 50; phosphatase fold	99.82
1g5b_A		221	Serine/threonine protein phosphatase; bacteriophag	99.81
1xzw_A		426	Purple acid phosphatase; hydrolase; HET: NAG FUC M	99.77
2qfp_A		424	Purple acid phosphatase; binuclear, Fe-Zn, hydrola	99.74
2qjc_A		262	Diadenosine tetraphosphatase, putative; putative d	99.65
1hp1_A		516	5'-nucleotidase; metallophosphatase, dinuclear, me	99.39
2z72_A		342	Protein-tyrosine-phosphatase; cold-active enzyme,	99.37
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	99.32
3qfk_A		527	Uncharacterized protein; structural genomics, cent	99.26
2wdc_A		562	SOXB, sulfur oxidation protein SOXB; sulfur-sulfur	99.22
2yeq_A		527	Apased, PHOD, alkaline phosphatase D; hydrolase, p	99.22
2z1a_A		552	5'-nucleotidase; metal-binding, nucleotide-binding	99.2
3ive_A		509	Nucleotidase; structural genomics, PSI-2, protein	99.18
3h63_A		315	Serine/threonine-protein phosphatase 5; metalloenz	99.15
2ie4_C		309	PP2A-alpha;, serine/threonine-protein phosphatase	99.09
3ztv_A		579	NAD nucleotidase, NADN; hydrolase, NAD pyrophospha	99.08
2dfj_A		280	Diadenosinetetraphosphatase; helices and strands m	99.02
1fjm_A		330	Protein serine/threonine phosphatase-1 (alpha ISO	98.97
3icf_A		335	PPT, serine/threonine-protein phosphatase T; IRO m	98.97
4h2g_A		546	5'-nucleotidase; dimer, hydrolase, phosphatase, ex	98.92
3jyf_A		339	2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n	98.88
3e7a_A		299	PP-1A, serine/threonine-protein phosphatase PP1-al	98.84
1aui_A		521	Calcineurin, serine/threonine phosphatase 2B; hydr	98.83
3gve_A		341	YFKN protein; alpha-beta-BETA-alpha sandwich, stru	98.83
1t71_A		281	Phosphatase, conserved HYPO; crystal, X-RAY crysta	98.81
3ll8_A		357	Serine/threonine-protein phosphatase 2B catalytic	98.75
3c9f_A		557	5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p	98.73
4h1s_A		530	5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo	98.67
1t70_A		255	Phosphatase; crystal, X-RAY crystallography, struc	98.59
3e0j_A		476	DNA polymerase subunit delta-2; DNA polymerase del	98.49
2z06_A		252	Putative uncharacterized protein TTHA0625; metal b	98.44
3flo_A		460	DNA polymerase alpha subunit B; protein-protein co	97.76
2d00_A		109	V-type ATP synthase subunit F; V-ATPase, CHEY, FRE	88.91
2ov6_A		101	V-type ATP synthase subunit F; F subunit, A1AO ATP	86.59

>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A	Back alignment and structure

Probab=100.00  E-value=7.7e-35  Score=220.33  Aligned_cols=182  Identities=81%  Similarity=1.308  Sum_probs=152.7

Q ss_pred             CeEEEEeeccCCCCCCCChHHHHHhhcCCCccEEEEcCCCCChHHHHHHHhcCCcEEEecCCCCCCCCCCcceEEEeCCE
Q psy10859          1 MLVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRGDFDEGTSYPEKKVVTVGQF   80 (224)
Q Consensus         1 mki~~isDiH~~~~~~~~~~~l~~~~~~~~~D~vi~~GDl~~~~~~~~l~~l~~~v~~v~GNHD~~~~~~~~~~~~~~~~   80 (224)
                      |||+++||+|++.....+.+.+.+.++..++|+|+++||+++.++++.|+++..|+++|+||||....+|.         
T Consensus        11 m~i~~iSD~H~~~~~~~~~~~l~~~~~~~~~d~ii~~GDl~~~~~~~~l~~~~~~~~~v~GNhD~~~~lp~---------   81 (192)
T 1z2w_A           11 MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPE---------   81 (192)
T ss_dssp             CEEEEECCCCBTTTCSSCCHHHHTTCCTTSCSEEEECSCCBSHHHHHHHHHHCSEEEECCCTTCCCTTSCS---------
T ss_pred             eEEEEEecCCCCccchhHHHHHHHHhccCCCCEEEEcCCCCCHHHHHHHHhcCCCEEEEcCCcCccccCCc---------
Confidence            89999999998654334556777777667899999999999999999999987799999999998643322         


Q ss_pred             EEEeeecCcccCCCCHHHHHHHHHhhcCCCCCCceeeeeCCeEEEeeccCCCCCCCCHHHHHHHhhhcCCcEEEECCCCC
Q psy10859         81 RIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHK  160 (224)
Q Consensus        81 ~~~~~~g~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~i~~~H~~~~~~~~~~~~l~~~~~~~~~~~vi~GH~H~  160 (224)
                                                       ......++.+|+++|+++..++.+++.+..+++..+++++++||+|.
T Consensus        82 ---------------------------------~~~~~~~~~~i~l~Hg~~~~~~~~~~~l~~~~~~~~~d~vi~GHtH~  128 (192)
T 1z2w_A           82 ---------------------------------QKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHK  128 (192)
T ss_dssp             ---------------------------------EEEEEETTEEEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCC
T ss_pred             ---------------------------------ceEEEECCEEEEEECCCcCCCCCCHHHHHHHHHhcCCCEEEECCcCc
Confidence                                             22334466778889988877777777777777778999999999999


Q ss_pred             CceEEEcCEEEEcCCCCCCCCCCCCCCCCCeEEEEEEeCCeEEEEEEEeecCceeEEEEeeccC
Q psy10859        161 FEAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS  224 (224)
Q Consensus       161 ~~~~~~~~~~~in~Gs~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  224 (224)
                      +.....++++++||||++.++.|++....++|+++++++++++++++++..+++.+++++|+|.
T Consensus       129 ~~~~~~~~~~~inpGS~~~~~~~~~~~~~~~y~il~~~~~~~~~~~~~~~~~~~~v~~~~~~~~  192 (192)
T 1z2w_A          129 FEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS  192 (192)
T ss_dssp             CEEEEETTEEEEECCCTTCCCCSSCSCCCCEEEEEEEETTEEEEEEEEEETTEEEEEEEEEECC
T ss_pred             CccEeECCEEEEECCcccccCCCCCcCCCCcEEEEEEECCEEEEEEEEccCCEEEEEEEEEccC
Confidence            9988889999999999987655656667899999999999999999999999999999999874

PyMOL of 1z2w

>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7	Back alignment and structure

>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7	Back alignment and structure

>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima}	Back alignment and structure

>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A	Back alignment and structure

>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A*	Back alignment and structure

>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A	Back alignment and structure

>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A	Back alignment and structure

>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A	Back alignment and structure

>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6	Back alignment and structure

>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6	Back alignment and structure

>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0	Back alignment and structure

>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7	Back alignment and structure

>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12	Back alignment and structure

>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes}	Back alignment and structure

>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A*	Back alignment and structure

>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A*	Back alignment and structure

>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B*	Back alignment and structure

>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens}	Back alignment and structure

>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A*	Back alignment and structure

>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8	Back alignment and structure

>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A	Back alignment and structure

>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A*	Back alignment and structure

>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C	Back alignment and structure

>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A	Back alignment and structure

>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7}	Back alignment and structure

>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3	Back alignment and structure

>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1	Back alignment and structure

>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A*	Back alignment and structure

>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei}	Back alignment and structure

>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A	Back alignment and structure

>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp}	Back alignment and structure

>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A	Back alignment and structure

>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis}	Back alignment and structure

>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2	Back alignment and structure

>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A*	Back alignment and structure

>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A	Back alignment and structure

>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C*	Back alignment and structure

>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A*	Back alignment and structure

>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A}	Back alignment and structure

>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3	Back alignment and structure

>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae}	Back alignment and structure

>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A*	Back alignment and structure

>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A*	Back alignment and structure

>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3	Back alignment and structure

>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp}	Back alignment and structure

>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9	Back alignment and structure

>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A	Back alignment and structure

>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2	Back alignment and structure

>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens}	Back alignment and structure

>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9	Back alignment and structure

>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens}	Back alignment and structure

>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A	Back alignment and structure

>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2d00_A V-type ATP synthase subunit F; V-ATPase, CHEY, FRET, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.149.1.1 PDB: 3a5c_H* 3a5d_H 3j0j_H*	Back alignment and structure

>2ov6_A V-type ATP synthase subunit F; F subunit, A1AO ATP synthase, hydrolase; NMR {Methanosarcina mazei}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		224
d2a22a1		193	d.159.1.7 (A:4-196) Vacuolar protein sorting 29, V	8e-59
d1z2wa1		182	d.159.1.7 (A:1-182) Vacuolar protein sorting 29, V	8e-53
d1s3la_		165	d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {	3e-17
d3ck2a1		173	d.159.1.7 (A:1-173) Uncharacterized protein SP1879	1e-16
d1su1a_		184	d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia	9e-12
d3d03a1		271	d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ	2e-05
d1uf3a_		228	d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu	5e-05
d1g5ba_		219	d.159.1.3 (A:) lambda ser/thr protein phosphatase	8e-05
d2nxfa1		320	d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo	5e-04
d2yvta1		257	d.159.1.6 (A:4-260) Uncharacterized protein Aq_195	0.002

>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Length = 193	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Cryptosporidium parvum [TaxId: 5807]

 Score =  181 bits (461), Expect = 8e-59
 Identities = 82/222 (36%), Positives = 123/222 (55%), Gaps = 33/222 (14%)

Query: 2   LVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRG 61
           LVL++GDL IP+    LP+ F++LL   +I ++LCTGN+ ++E  + LK +  +V++V G
Sbjct: 5   LVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSG 64

Query: 62  DFDEGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQ 121
           D D     P+ +                                     +PE  VV +G+
Sbjct: 65  DLDSAIFNPDPES---------------------------------NGVFPEYVVVQIGE 91

Query: 122 FRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHKFEAYEHENKFYINPGSATGAF 181
           F+IGL HG+ ++PW DP +L   QR+LD DIL++GHTHK   +E   K ++NPG+ATGAF
Sbjct: 92  FKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAF 151

Query: 182 NPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKK 223
           + L P   PSF+LM +Q + VV YVY L   +  V   ++ K
Sbjct: 152 SALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK 193

PyMOL of d2a22a1

>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Length = 182	Back information, alignment and structure

>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Length = 165	Back information, alignment and structure

>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Length = 173	Back information, alignment and structure

>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184	Back information, alignment and structure

>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Length = 271	Back information, alignment and structure

>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228	Back information, alignment and structure

>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219	Back information, alignment and structure

>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320	Back information, alignment and structure

>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Length = 257	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		224
d1z2wa1		182	Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus	100.0
d2a22a1		193	Vacuolar protein sorting 29, VPS29 {Cryptosporidiu	100.0
d3ck2a1		173	Uncharacterized protein SP1879 {Streptococcus pneu	99.97
d1s3la_		165	Putative phosphodiesterase MJ0936 {Methanococcus j	99.97
d2yvta1		257	Uncharacterized protein Aq_1956 {Aquifex aeolicus	99.94
d1uf3a_		228	Hypothetical protein TT1561 {Thermus thermophilus	99.94
d2hy1a1		256	Rv0805 cyclic nucleotide phosphodiesterase {Mycoba	99.93
d1su1a_		184	Phosphodiesterase yfcE {Escherichia coli [TaxId: 5	99.93
d3d03a1		271	Glycerophosphodiesterase GpdQ {Enterobacter aeroge	99.93
d1nnwa_		251	Hypothetical protein PF1291 {Archaeon Pyrococcus f	99.92
d2nxfa1		320	Uncharacterized C17orf48 homolog zgc:64213 {Zebraf	99.85
d1ii7a_		333	Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	99.84
d2qfra2		312	Plant purple acid phosphatase, catalytic domain {K	99.78
d1utea_		302	Mammalian purple acid phosphatase {Pig (Sus scrofa	99.75
d1xm7a_		188	Hypothetical protein aq_1666 {Aquifex aeolicus [Ta	99.61
d1g5ba_		219	lambda ser/thr protein phosphatase {Bacteriophage	99.59
d1usha2		337	5'-nucleotidase (syn. UDP-sugar hydrolase), N-term	99.24
d3c9fa2		322	5'-nucleotidase (syn. UDP-sugar hydrolase), N-term	98.82
d2z1aa2		302	5'-nucleotidase (syn. UDP-sugar hydrolase), N-term	98.69
d1s95a_		324	Serine/threonine protein phosphatase 5, PP5 {Human	98.38
d1auia_		473	Protein phosphatase-2B (PP-2B, calcineurin A subun	98.13
d3c5wc1		288	Protein phosphatase 2A catalytic subunit alpha iso	98.13
d1jk7a_		294	Protein phosphatase-1 (PP-1) {Human (Homo sapiens)	98.06
d1t70a_		255	Putative phosphatase DR1281 {Deinococcus radiodura	97.68
d2z06a1		252	Hypothetical protein TTHA0625 {Thermus thermophilu	97.62
d1t71a_		281	Hypothetical protein MPN349 {Mycoplasma pneumoniae	97.44

>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=5.5e-39  Score=238.42  Aligned_cols=182  Identities=81%  Similarity=1.308  Sum_probs=155.4

Q ss_pred             CeEEEEeeccCCCCCCCChHHHHHhhcCCCccEEEEcCCCCChHHHHHHHhcCCcEEEecCCCCCCCCCCcceEEEeCCE
Q psy10859          1 MLVLVLGDLHIPHRTSGLPAKFKKLLVPGRIQHILCTGNLVTKETFDYLKTLASDVHVVRGDFDEGTSYPEKKVVTVGQF   80 (224)
Q Consensus         1 mki~~isDiH~~~~~~~~~~~l~~~~~~~~~D~vi~~GDl~~~~~~~~l~~l~~~v~~v~GNHD~~~~~~~~~~~~~~~~   80 (224)
                      |||++|||+|++.+..++++.+.+.++..++|.++|+||++++++++.|++++.++++|.||||....+|....      
T Consensus         1 MkI~viSD~H~~~~~~~l~~~~~~~~~~~~~D~Ii~~GDi~~~e~l~~l~~~~~~v~~V~GN~D~~~~~p~~~~------   74 (182)
T d1z2wa1           1 MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKV------   74 (182)
T ss_dssp             CEEEEECCCCBTTTCSSCCHHHHTTCCTTSCSEEEECSCCBSHHHHHHHHHHCSEEEECCCTTCCCTTSCSEEE------
T ss_pred             CEEEEEeecCCCCcchhhHHHHHHHhcccCCCEEEEccCccchhhHHHHHhhCCceEEEeCCcCcccccceEEE------
Confidence            99999999999776546667788887777899999999999999999999998899999999998654454433      


Q ss_pred             EEEeeecCcccCCCCHHHHHHHHHhhcCCCCCCceeeeeCCeEEEeeccCCCCCCCCHHHHHHHhhhcCCcEEEECCCCC
Q psy10859         81 RIGLCHGHDIIPWGDPEALALLQRQLDGTSYPEKKVVTVGQFRIGLCHGHDIIPWGDPEALALLQRQLDVDILISGHTHK  160 (224)
Q Consensus        81 ~~~~~~g~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~i~~~H~~~~~~~~~~~~l~~~~~~~~~~~vi~GH~H~  160 (224)
                                                          +...+.+++++|+++..++...+.+...++..++|++++||||.
T Consensus        75 ------------------------------------~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~divi~GHTH~  118 (182)
T d1z2wa1          75 ------------------------------------VTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHK  118 (182)
T ss_dssp             ------------------------------------EEETTEEEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCC
T ss_pred             ------------------------------------EEEcCcEEEEEeCCCCCCCCCHHHHHHHHhccCCCEEEECCcCc
Confidence                                                34455566777777766777777787778888999999999999


Q ss_pred             CceEEEcCEEEEcCCCCCCCCCCCCCCCCCeEEEEEEeCCeEEEEEEEeecCceeEEEEeeccC
Q psy10859        161 FEAYEHENKFYINPGSATGAFNPLEPKVNPSFVLMDIQSSNVVTYVYQLIADEVTVERIDYKKS  224 (224)
Q Consensus       161 ~~~~~~~~~~~in~Gs~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  224 (224)
                      +.....++++++||||++.++.+......++|+++|+++++++++++++.+++++.++++|+||
T Consensus       119 p~~~~~~~~~~iNPGSv~~pr~~~~~~~~~syaild~~~~~v~~~~~~l~~~~v~~~~~~~~~~  182 (182)
T d1z2wa1         119 FEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS  182 (182)
T ss_dssp             CEEEEETTEEEEECCCTTCCCCSSCSCCCCEEEEEEEETTEEEEEEEEEETTEEEEEEEEEECC
T ss_pred             ceEEEECCEEEEeCCCCCCCCCCCCCCCCCEEEEEEEeCCEEEEEEEEecCCcEEEEEEEEEcC
Confidence            9999999999999999997544444466789999999999999999999999999999999997

PyMOL of d1z2wa1

>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}	Back information, alignment and structure

>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]}	Back information, alignment and structure

>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]}	Back information, alignment and structure

>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]}	Back information, alignment and structure

>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}	Back information, alignment and structure

>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]}	Back information, alignment and structure