Diaphorina citri psyllid: psy10879

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
DNISANQTGLSKFKNLKHSYFIVILILTSSKNYIRRKNIRDTWIKNIEKYQVKYLFSIGNKENVVDVKLKEEIRRYDDILLLNQVPDEYSSLSQKVLHSFKYIYEHFDFQYLLKCDDDTFVRVPNIIHELENKFHYEKKLYWGFFDGRARVRRAGKWKEKNWFLCDRYLPYALGGGYVLSHLLVKFISENSHMLSSYISEDVSVGVWLSALDITRYHDVRFDTEFQSRGCNNSYLIVHKQNMHQL
cccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHHcccEEcccccccccccHHHHHHHHHHHHHHcccEEEEEEccccEEECHHHHHHHHHcccccccEEEEEEEEccccccccccEEEccccccccccccccccEEEEcHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccccccccEEEEcccccccc
***********KFKNLKHSYFIVILILTSSKNYIRRKNIRDTWIKNIEKYQVKYLFSIGNKENVVDVKLKEEIRRYDDILLLNQVPDEYSSLSQKVLHSFKYIYEHFDFQYLLKCDDDTFVRVPNIIHELENKFHYEKKLYWGFFDGRARVRRAGKWKEKNWFLCDRYLPYALGGGYVLSHLLVKFISENSHMLSSYISEDVSVGVWLSALDITRYHDVRFDTEFQSRGCNNSYLIVHKQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DNISANQTGLSKFKNLKHSYFIVILILTSSKNYIRRKNIRDTWIKNIEKYQVKYLFSIGNKENVVDVKLKEEIRRYDDILLLNQVPDEYSSLSQKVLHSFKYIYEHFDFQYLLKCDDDTFVRVPNIIHELENKFHYEKKLYWGFFDGRARVRRAGKWKEKNWFLCDRYLPYALGGGYVLSHLLVKFISENSHMLSSYISEDVSVGVWLSALDITRYHDVRFDTEFQSRGCNNSYLIVHKQNMHQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-1,3-galactosyltransferase 6 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. Has no activity towards substrates with terminal glucosamine or galactosamine residues.confidentQ91Z92
Beta-1,3-galactosyltransferase sqv-2 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Required for vulval morphogenesis and zygotic cytokinesis, suggesting that glycosaminoglycans play a central role in vulval morphogenesis.confidentQ9N491
Beta-1,3-galactosyltransferase 6 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. Has no activity towards substrates with terminal glucosamine or galactosamine residues.confidentQ96L58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006024 [BP]glycosaminoglycan biosynthetic processprobableGO:1901576, GO:0044710, GO:0030203, GO:1901564, GO:1901566, GO:1901137, GO:1901135, GO:0043170, GO:0008150, GO:0071704, GO:0009058, GO:0009059, GO:0006807, GO:0008152, GO:0006022, GO:0006023
GO:0008499 [MF]UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activityprobableGO:0003674, GO:0035250, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194, GO:0048531
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0047220 [MF]galactosylxylosylprotein 3-beta-galactosyltransferase activityprobableGO:0003674, GO:0035250, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0008194
GO:0005797 [CC]Golgi medial cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005975 [BP]carbohydrate metabolic processprobableGO:0044238, GO:0008150, GO:0008152, GO:0071704

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.134Galactosylxylosylprotein 3-beta-galactosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:confident
Coverage over the Query: 19-147,168-238
View the alignment between query and template
View the model in PyMOL