Diaphorina citri psyllid: psy10880


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MMMVDGEWWMADDDNNDDDDDDDDDDDDDDDDDDDDDDDDDDEVIITCKTLISRLTTQRWLDVGPSWTEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSGDYCTKAVQKLSPTKALPNRTSRTLFCVLEPSMQLYGNCAK
ccCEccCEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccCECccEEEEEEEEEEEccccccccccccccccccccccCEEccccccEEccccccccccccccccccccccccccccccccEEEcccccccccccc
***VDGEWWMADDDNNDDDDDDDDDDDDDDDDDDDDDDDDDDEVIITCKTLISRLTTQRWLDVGPS*TEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSGDYCTKAVQKLSPTKALPNRTSRTLFCVLEPSMQLYGNC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMVDGEWWMADDDNNDDDDDDDDDDDDDDDDDDDDDDDDDDEVIITCKTLISRLTTQRWLDVGPSWTEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSGDYCTKAVQKLSPTKALPNRTSRTLFCVLEPSMQLYGNCAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Delta-like protein D Acts as a ligand for Notch receptors and is involved in primary neurogenesis and somitogenesis. Can activate Notch receptors, thereby playing a key role in lateral inhibition, a process that prevents the immediate neighbors of each nascent neural cell from simultaneously embarking on neural differentiation. Required in somite segmentation to keep the oscillations of neighboring presomitic mesoderm cells synchronized.confidentQ8UWJ4
Delta-like protein 1 Acts as a ligand for Notch receptors. Blocks the differentiation of progenitor cells into the B-cell lineage while promoting the emergence of a population of cells with the characteristics of a T-cell/NK-cell precursor.confidentO00548
Delta-like protein 1 May be involved in cell-to-cell communication in mammalian embryos. May have a role in cellular interactions underlying somitogenesis and development of the nervous system.confidentQ61483

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045747 [BP]positive regulation of Notch signaling pathwayprobableGO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008593, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0007368 [BP]determination of left/right symmetryprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0050767 [BP]regulation of neurogenesisprobableGO:0030154, GO:0007275, GO:0044699, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0045638 [BP]negative regulation of myeloid cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0050789, GO:0045596, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0002682, GO:0045637, GO:0048523
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0043009 [BP]chordate embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VJ2, chain A
Confidence level:very confident
Coverage over the Query: 87-161
View the alignment between query and template
View the model in PyMOL
Template: 3K8P, chain C
Confidence level:probable
Coverage over the Query: 32-91
View the alignment between query and template
View the model in PyMOL