Psyllid ID: psy10880
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| 208972117 | 858 | Delta protein [Periplaneta americana] | 0.5 | 0.096 | 0.795 | 2e-33 | |
| 383848693 | 863 | PREDICTED: neurogenic locus protein delt | 0.487 | 0.093 | 0.753 | 7e-32 | |
| 328787266 | 892 | PREDICTED: neurogenic locus protein delt | 0.487 | 0.090 | 0.740 | 1e-31 | |
| 350408086 | 924 | PREDICTED: LOW QUALITY PROTEIN: neurogen | 0.487 | 0.087 | 0.728 | 2e-31 | |
| 380030890 | 83 | PREDICTED: neurogenic locus protein delt | 0.487 | 0.975 | 0.740 | 4e-31 | |
| 340721886 | 919 | PREDICTED: neurogenic locus protein delt | 0.487 | 0.088 | 0.716 | 5e-31 | |
| 322786495 | 87 | hypothetical protein SINV_03001 [Solenop | 0.487 | 0.931 | 0.703 | 4e-28 | |
| 189233683 | 778 | PREDICTED: similar to Delta [Tribolium c | 0.5 | 0.106 | 0.674 | 4e-28 | |
| 270014506 | 775 | hypothetical protein TcasGA2_TC004114 [T | 0.493 | 0.105 | 0.682 | 6e-28 | |
| 354684016 | 542 | Delta protein, partial [Gryllus bimacula | 0.5 | 0.153 | 0.662 | 7e-27 |
| >gi|208972117|gb|ACI32657.1| Delta protein [Periplaneta americana] | Back alignment and taxonomy information |
|---|
Score = 147 bits (370), Expect = 2e-33, Method: Compositional matrix adjust.
Identities = 66/83 (79%), Positives = 71/83 (85%)
Query: 49 KTLISRLTTQRWLDVGPSWTEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFG 108
+TLI+RLTTQRWLDVG WTEDEH+S+HS M YEYRVTCD HYYG GCA LCRPRDD+FG
Sbjct: 148 ETLITRLTTQRWLDVGEDWTEDEHRSSHSVMRYEYRVTCDAHYYGAGCANLCRPRDDNFG 207
Query: 109 HYTCSHTGDRKCLPGWSGDYCTK 131
HY CS TGDR CL GW GDYCTK
Sbjct: 208 HYKCSATGDRVCLSGWQGDYCTK 230
|
Source: Periplaneta americana Species: Periplaneta americana Genus: Periplaneta Family: Blattidae Order: Blattodea Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383848693|ref|XP_003699982.1| PREDICTED: neurogenic locus protein delta-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328787266|ref|XP_393831.4| PREDICTED: neurogenic locus protein delta [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350408086|ref|XP_003488297.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus protein delta-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380030890|ref|XP_003699072.1| PREDICTED: neurogenic locus protein delta-like, partial [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340721886|ref|XP_003399344.1| PREDICTED: neurogenic locus protein delta-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|322786495|gb|EFZ12940.1| hypothetical protein SINV_03001 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|189233683|ref|XP_970087.2| PREDICTED: similar to Delta [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014506|gb|EFA10954.1| hypothetical protein TcasGA2_TC004114 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|354684016|gb|AER35117.1| Delta protein, partial [Gryllus bimaculatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| RGD|70949 | 714 | Dll1 "delta-like 1 (Drosophila | 0.5 | 0.116 | 0.566 | 1.8e-25 | |
| UNIPROTKB|P97677 | 714 | Dll1 "Delta-like protein 1" [R | 0.5 | 0.116 | 0.566 | 1.8e-25 | |
| MGI|MGI:104659 | 722 | Dll1 "delta-like 1 (Drosophila | 0.5 | 0.114 | 0.566 | 2.4e-25 | |
| UNIPROTKB|F1PNN6 | 689 | DLL1 "Delta-like protein" [Can | 0.5 | 0.120 | 0.554 | 3.5e-25 | |
| UNIPROTKB|I3LNT3 | 722 | DLL1 "Delta-like protein" [Sus | 0.5 | 0.114 | 0.554 | 3.9e-25 | |
| UNIPROTKB|O00548 | 723 | DLL1 "Delta-like protein 1" [H | 0.5 | 0.114 | 0.554 | 5e-25 | |
| UNIPROTKB|F1NRS3 | 728 | DLL1 "Delta-like protein" [Gal | 0.5 | 0.114 | 0.554 | 5.1e-25 | |
| UNIPROTKB|E1BN18 | 722 | DLL1 "Delta-like protein" [Bos | 0.5 | 0.114 | 0.542 | 1.3e-24 | |
| FB|FBgn0000463 | 833 | Dl "Delta" [Drosophila melanog | 0.716 | 0.142 | 0.450 | 5.7e-23 | |
| ZFIN|ZDB-GENE-990415-47 | 717 | dld "deltaD" [Danio rerio (tax | 0.5 | 0.115 | 0.518 | 1.9e-22 |
| RGD|70949 Dll1 "delta-like 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 298 (110.0 bits), Expect = 1.8e-25, P = 1.8e-25
Identities = 47/83 (56%), Positives = 57/83 (68%)
Query: 51 LISRLTTQRWLDVGPSWTEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHY 110
LISRLTTQR L VG W++D H S + + Y YR CD HYYG GC+ CRPRDD+FGH+
Sbjct: 142 LISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDEHYYGEGCSVFCRPRDDAFGHF 201
Query: 111 TCSHTGDRKCLPGWSGDYCTKAV 133
TC G++ C PGW G YCT +
Sbjct: 202 TCGERGEKMCDPGWKGQYCTDPI 224
|
|
| UNIPROTKB|P97677 Dll1 "Delta-like protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104659 Dll1 "delta-like 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PNN6 DLL1 "Delta-like protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LNT3 DLL1 "Delta-like protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00548 DLL1 "Delta-like protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRS3 DLL1 "Delta-like protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BN18 DLL1 "Delta-like protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000463 Dl "Delta" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990415-47 dld "deltaD" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| pfam01414 | 63 | pfam01414, DSL, Delta serrate ligand | 4e-24 | |
| smart00051 | 63 | smart00051, DSL, delta serrate ligand | 8e-22 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 4e-08 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 5e-08 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-08 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 2e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-07 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-07 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-07 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-07 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-07 | |
| PTZ00007 | 337 | PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr | 6e-07 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 7e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 9e-07 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-06 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-06 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-06 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 2e-06 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 3e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-06 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-06 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-06 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 3e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-06 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 4e-06 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 4e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 4e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 5e-06 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 5e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-06 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 7e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 7e-06 | |
| PTZ00007 | 337 | PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr | 7e-06 | |
| PTZ00007 | 337 | PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr | 7e-06 | |
| PHA02608 | 80 | PHA02608, 67, prohead core protein; Provisional | 7e-06 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 7e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 8e-06 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 8e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 9e-06 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 9e-06 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 9e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-05 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-05 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 1e-05 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 1e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 2e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 2e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 2e-05 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 2e-05 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-05 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 2e-05 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-05 | |
| PTZ00007 | 337 | PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr | 3e-05 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 3e-05 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 3e-05 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 4e-05 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 4e-05 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 4e-05 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 4e-05 | |
| pfam04281 | 136 | pfam04281, Tom22, Mitochondrial import receptor su | 4e-05 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-05 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 5e-05 | |
| PTZ00007 | 337 | PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr | 5e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 5e-05 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 5e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-05 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 5e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-05 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 7e-05 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 7e-05 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 7e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-05 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 8e-05 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 1e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-04 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 1e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-04 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 1e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-04 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 1e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-04 | |
| pfam13324 | 271 | pfam13324, GCIP, Grap2 and cyclin-D-interacting | 1e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 1e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 1e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-04 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 2e-04 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 2e-04 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 2e-04 | |
| pfam07093 | 557 | pfam07093, SGT1, SGT1 protein | 2e-04 | |
| PLN00151 | 852 | PLN00151, PLN00151, potassium transporter; Provisi | 2e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-04 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 3e-04 | |
| pfam08595 | 141 | pfam08595, RXT2_N, RXT2-like, N-terminal | 3e-04 | |
| pfam04281 | 136 | pfam04281, Tom22, Mitochondrial import receptor su | 3e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-04 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 3e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 3e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 3e-04 | |
| smart00017 | 287 | smart00017, OSTEO, Osteopontin | 3e-04 | |
| PTZ00007 | 337 | PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr | 4e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 4e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 4e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 4e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 4e-04 | |
| COG0452 | 392 | COG0452, Dfp, Phosphopantothenoylcysteine syntheta | 4e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 5e-04 | |
| smart00017 | 287 | smart00017, OSTEO, Osteopontin | 5e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 5e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-04 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 6e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-04 | |
| PHA03209 | 357 | PHA03209, PHA03209, serine/threonine kinase US3; P | 6e-04 | |
| pfam04281 | 136 | pfam04281, Tom22, Mitochondrial import receptor su | 7e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-04 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 8e-04 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 8e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.001 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.001 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 0.001 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.001 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.001 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.001 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.001 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.001 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| pfam04281 | 136 | pfam04281, Tom22, Mitochondrial import receptor su | 0.002 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.002 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.002 | |
| COG0452 | 392 | COG0452, Dfp, Phosphopantothenoylcysteine syntheta | 0.002 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.003 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.003 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.003 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.003 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.003 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.003 | |
| smart00017 | 287 | smart00017, OSTEO, Osteopontin | 0.003 | |
| smart00017 | 287 | smart00017, OSTEO, Osteopontin | 0.003 | |
| PHA03346 | 520 | PHA03346, PHA03346, US22 family homolog; Provision | 0.003 | |
| pfam03986 | 146 | pfam03986, Autophagy_N, Autophagocytosis associate | 0.003 | |
| cd13394 | 597 | cd13394, Syo1_like, Fungal symportin 1 (syo1) and | 0.003 | |
| cd13394 | 597 | cd13394, Syo1_like, Fungal symportin 1 (syo1) and | 0.003 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.003 | |
| COG3416 | 233 | COG3416, COG3416, Uncharacterized protein conserve | 0.003 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.004 | |
| pfam11702 | 509 | pfam11702, DUF3295, Protein of unknown function (D | 0.004 | |
| pfam11702 | 509 | pfam11702, DUF3295, Protein of unknown function (D | 0.004 | |
| pfam11702 | 509 | pfam11702, DUF3295, Protein of unknown function (D | 0.004 | |
| pfam05086 | 910 | pfam05086, Dicty_REP, Dictyostelium (Slime Mold) R | 0.004 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.004 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 0.004 |
| >gnl|CDD|144855 pfam01414, DSL, Delta serrate ligand | Back alignment and domain information |
|---|
Score = 89.0 bits (221), Expect = 4e-24
Identities = 34/63 (53%), Positives = 43/63 (68%)
Query: 67 WTEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSG 126
W+ D H +++ Y+ RVTCD +YYG GC CRPRDD FGHYTC G+++CL GW G
Sbjct: 1 WSTDLHIVGRTNLEYQIRVTCDENYYGEGCNKFCRPRDDFFGHYTCDENGNKRCLNGWMG 60
Query: 127 DYC 129
YC
Sbjct: 61 PYC 63
|
Length = 63 |
| >gnl|CDD|128366 smart00051, DSL, delta serrate ligand | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|218003 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222046 pfam13324, GCIP, Grap2 and cyclin-D-interacting | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|219293 pfam07093, SGT1, SGT1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215079 PLN00151, PLN00151, potassium transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|218003 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214472 smart00017, OSTEO, Osteopontin | Back alignment and domain information |
|---|
| >gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223529 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214472 smart00017, OSTEO, Osteopontin | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218003 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218003 pfam04281, Tom22, Mitochondrial import receptor subunit Tom22 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|223529 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|214472 smart00017, OSTEO, Osteopontin | Back alignment and domain information |
|---|
| >gnl|CDD|214472 smart00017, OSTEO, Osteopontin | Back alignment and domain information |
|---|
| >gnl|CDD|223052 PHA03346, PHA03346, US22 family homolog; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217830 pfam03986, Autophagy_N, Autophagocytosis associated protein (Atg3), N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240521 cd13394, Syo1_like, Fungal symportin 1 (syo1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240521 cd13394, Syo1_like, Fungal symportin 1 (syo1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225950 COG3416, COG3416, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221173 pfam11702, DUF3295, Protein of unknown function (DUF3295) | Back alignment and domain information |
|---|
| >gnl|CDD|221173 pfam11702, DUF3295, Protein of unknown function (DUF3295) | Back alignment and domain information |
|---|
| >gnl|CDD|221173 pfam11702, DUF3295, Protein of unknown function (DUF3295) | Back alignment and domain information |
|---|
| >gnl|CDD|218421 pfam05086, Dicty_REP, Dictyostelium (Slime Mold) REP protein | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| smart00051 | 63 | DSL delta serrate ligand. | 99.74 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 99.73 | |
| KOG1225|consensus | 525 | 98.8 | ||
| KOG1219|consensus | 4289 | 98.72 | ||
| KOG1225|consensus | 525 | 98.66 | ||
| KOG4289|consensus | 2531 | 98.19 | ||
| KOG4289|consensus | 2531 | 97.79 | ||
| KOG1226|consensus | 783 | 97.54 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 97.47 | |
| KOG1214|consensus | 1289 | 97.46 | ||
| KOG1226|consensus | 783 | 97.46 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.3 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 97.08 | |
| KOG4260|consensus | 350 | 96.89 | ||
| KOG1219|consensus | 4289 | 96.88 | ||
| KOG1217|consensus | 487 | 96.84 | ||
| KOG1217|consensus | 487 | 96.45 | ||
| KOG0994|consensus | 1758 | 95.67 | ||
| PF09026 | 101 | CENP-B_dimeris: Centromere protein B dimerisation | 95.44 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 95.4 | |
| KOG1218|consensus | 316 | 95.32 | ||
| KOG0943|consensus | 3015 | 95.14 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 95.14 | |
| PHA02608 | 80 | 67 prohead core protein; Provisional | 95.1 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 95.09 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 94.67 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 94.63 | |
| KOG1218|consensus | 316 | 94.46 | ||
| KOG0994|consensus | 1758 | 94.33 | ||
| KOG1836|consensus | 1705 | 92.81 | ||
| PF09026 | 101 | CENP-B_dimeris: Centromere protein B dimerisation | 92.71 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 92.26 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 90.27 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 89.81 | |
| KOG1214|consensus | 1289 | 89.78 | ||
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 88.62 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 87.46 | |
| PF14812 | 81 | PBP1_TM: Transmembrane domain of transglycosylase | 85.49 | |
| KOG3130|consensus | 514 | 84.86 | ||
| KOG3607|consensus | 716 | 84.65 | ||
| KOG3512|consensus | 592 | 84.58 | ||
| PF03153 | 375 | TFIIA: Transcription factor IIA, alpha/beta subuni | 83.87 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 83.71 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 83.46 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 83.34 | |
| KOG2652|consensus | 348 | 83.21 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 80.2 |
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
Probab=99.74 E-value=1.9e-18 Score=116.89 Aligned_cols=63 Identities=54% Similarity=1.314 Sum_probs=60.8
Q ss_pred CcccccccceeeeceeEEEecCCCCCCCCCCCCCCCCCCCCCcccCCCCCCccCCCCCCCCCC
Q psy10880 67 WTEDEHKSAHSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSGDYC 129 (166)
Q Consensus 67 W~~~~~~~~~~~l~~~~r~~C~~gyyG~~C~~~C~p~~~~~ghy~C~~~G~c~C~~GwtG~~C 129 (166)
|++.++.+..+.|.+++|+.|+++|||..|+++|+|+++.++||+|++.|.|+|+|||+|++|
T Consensus 1 w~~~~~~~~~~~l~~~~rv~C~~~~yG~~C~~~C~~~~d~~~~~~Cd~~G~~~C~~Gw~G~~C 63 (63)
T smart00051 1 WSTDLHIGGRTFLEYQIRVTCDENYYGEGCNKFCRPRDDFFGHYTCDENGNKGCLEGWMGPYC 63 (63)
T ss_pred CcccccccccceEEEEEEeeCCCCCcCCccCCEeCcCccccCCccCCcCCCEecCCCCcCCCC
Confidence 888899999999999999999999999999999999999999999999999999999999987
|
|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >KOG0943|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PHA02608 67 prohead core protein; Provisional | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF14812 PBP1_TM: Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A | Back alignment and domain information |
|---|
| >KOG3130|consensus | Back alignment and domain information |
|---|
| >KOG3607|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >PF03153 TFIIA: Transcription factor IIA, alpha/beta subunit; InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG2652|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 166 | ||||
| 2vj2_A | 169 | Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 | 9e-12 |
| >pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 3e-15 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-07 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-07 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-07 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-07 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 2e-06 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-06 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-06 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 5e-06 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 6e-06 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 9e-06 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 4e-05 | |
| 2ayu_A | 417 | Nucleosome assembly protein; histone chaperone; 3. | 8e-05 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 2e-05 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 6e-05 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 6e-05 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 8e-05 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 1e-04 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 2e-04 | |
| 2zd7_A | 264 | VPS75, vacuolar protein sorting-associated protein | 6e-04 | |
| 3h0g_F | 142 | DNA-directed RNA polymerases I, II, and III subuni | 1e-04 | |
| 3ay5_A | 360 | Cyclin-D1-binding protein 1; dominant-negative hel | 2e-04 | |
| 1rm1_C | 286 | Transcription initiation factor IIA large chain; y | 2e-04 | |
| 3k8p_C | 357 | DSL1, KLLA0C02695P; intracellular trafficking, DSL | 2e-04 | |
| 3o4z_A | 647 | Telomere length regulation protein TEL2; heat like | 4e-04 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 4e-04 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 5e-04 | |
| 1sig_A | 339 | Sigma70, RNA polymerase primary sigma factor; RNA | 5e-04 | |
| 1sig_A | 339 | Sigma70, RNA polymerase primary sigma factor; RNA | 9e-04 | |
| 3fs3_A | 359 | Nucleosome assembly protein 1, putative; protein l | 6e-04 | |
| 3fs3_A | 359 | Nucleosome assembly protein 1, putative; protein l | 6e-04 | |
| 3fs3_A | 359 | Nucleosome assembly protein 1, putative; protein l | 8e-04 | |
| 1qkl_A | 127 | RPB6, DNA-directed RNA polymerase II 14.4 KD polyp | 7e-04 |
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
Score = 68.2 bits (167), Expect = 3e-15
Identities = 29/58 (50%), Positives = 36/58 (62%)
Query: 76 HSSMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSGDYCTKAV 133
H S+ VTCD +YYG GC CRPRDD FGHY C G++ C+ GW G C +A+
Sbjct: 10 HGSIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAI 67
|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264 | Back alignment and structure |
|---|
| >3h0g_F DNA-directed RNA polymerases I, II, and III subunit rpabc2; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 142 | Back alignment and structure |
|---|
| >3ay5_A Cyclin-D1-binding protein 1; dominant-negative helix-loop-helix transcriptional regulator cycle; 2.50A {Homo sapiens} Length = 360 | Back alignment and structure |
|---|
| >1rm1_C Transcription initiation factor IIA large chain; yeast TFIIA, TBP protein, ATA-box DNA, transcription/DNA complex; 2.50A {Saccharomyces cerevisiae} Length = 286 | Back alignment and structure |
|---|
| >3k8p_C DSL1, KLLA0C02695P; intracellular trafficking, DSL1 complex, multisubunit tethering complex, snare proteins; 2.60A {Kluyveromyces lactis} Length = 357 | Back alignment and structure |
|---|
| >3o4z_A Telomere length regulation protein TEL2; heat like helical repeats, protein binding; 3.10A {Saccharomyces cerevisiae} Length = 647 | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 | Back alignment and structure |
|---|
| >1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Length = 339 | Back alignment and structure |
|---|
| >1sig_A Sigma70, RNA polymerase primary sigma factor; RNA polymerase sigma factor, transcription regulation; 2.60A {Escherichia coli} SCOP: a.177.1.1 Length = 339 | Back alignment and structure |
|---|
| >3fs3_A Nucleosome assembly protein 1, putative; protein localization, histone recognition, structural analysis, CHA; 2.30A {Plasmodium falciparum} PDB: 3hfd_A 3gyw_A 3gyv_A Length = 359 | Back alignment and structure |
|---|
| >3fs3_A Nucleosome assembly protein 1, putative; protein localization, histone recognition, structural analysis, CHA; 2.30A {Plasmodium falciparum} PDB: 3hfd_A 3gyw_A 3gyv_A Length = 359 | Back alignment and structure |
|---|
| >3fs3_A Nucleosome assembly protein 1, putative; protein localization, histone recognition, structural analysis, CHA; 2.30A {Plasmodium falciparum} PDB: 3hfd_A 3gyw_A 3gyv_A Length = 359 | Back alignment and structure |
|---|
| >1qkl_A RPB6, DNA-directed RNA polymerase II 14.4 KD polypeptide; transcription; NMR {Homo sapiens} SCOP: a.143.1.2 Length = 127 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.43 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.16 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.11 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.09 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.01 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.94 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.92 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.92 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.88 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.79 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.77 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.57 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.55 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.55 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.42 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.42 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.37 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.37 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.32 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.31 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.3 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 98.24 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.08 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.04 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.96 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.87 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.86 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.76 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.75 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 97.7 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.63 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.6 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.57 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.56 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.56 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.56 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.48 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 97.47 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.42 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.37 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.35 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.33 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.31 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.29 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 97.25 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 97.22 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.17 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.15 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.07 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.05 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.03 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.96 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.93 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.85 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.49 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 96.24 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.19 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 96.16 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.03 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 96.0 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 95.94 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 95.92 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 95.81 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.81 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 95.77 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 95.61 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 95.3 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 95.11 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 94.95 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 94.68 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 94.4 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 94.3 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 94.28 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 94.24 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 94.02 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 93.84 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 93.77 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 93.46 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 93.41 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 93.18 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 93.07 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 93.04 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 93.01 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 92.68 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 92.23 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 92.13 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 91.98 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 91.76 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 91.63 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 91.62 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 91.11 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 90.63 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 90.47 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 90.39 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 90.16 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 90.01 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 89.67 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 86.91 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 86.76 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 86.62 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 85.76 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 85.69 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 85.18 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 84.88 | |
| 3g5c_A | 510 | ADAM 22; alpha/beta fold, cross-linked domain, cel | 82.69 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 82.27 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 81.73 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 80.61 |
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
Probab=99.43 E-value=2.6e-14 Score=110.98 Aligned_cols=83 Identities=36% Similarity=0.744 Sum_probs=59.8
Q ss_pred eeceeEEEecCCCCCCCCCCCCCCCCCCCCCcccCCCCCCccCCCCCCCCCCCccccCCCCCCCCCCccCCCCceeCCCC
Q psy10880 78 SMLYEYRVTCDPHYYGNGCATLCRPRDDSFGHYTCSHTGDRKCLPGWSGDYCTKAVQKLSPTKALPNRTSRTLFCVLEPS 157 (166)
Q Consensus 78 ~l~~~~r~~C~~gyyG~~C~~~C~p~~~~~ghy~C~~~G~c~C~~GwtG~~C~~~iC~~~c~~c~nG~C~~~~~C~C~~G 157 (166)
.+...++++|.++|+|..|+..|.+.....+|++|..+|+|+|.+||+|..|+.++|...+ .+.+|.|..+++|.|++|
T Consensus 12 ~~~~~~~c~C~~g~~G~~C~~~C~~~~~c~~~g~C~~~g~C~C~~G~~G~~C~~~~C~~~C-~~~~g~C~~~~~C~C~~G 90 (169)
T 2vj2_A 12 SIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGC-SPKHGSCKLPGDCRCQYG 90 (169)
T ss_dssp ---------CCTTEETTTTCEECCCEEETTEEEEECSSCCEEECTTEESTTSCEECCCTTC-CTTTEECSSTTCCEECTT
T ss_pred ccccCeeeeCCCcCcCCCcccccCCCCCcCCCCEeCCCCeeECCCCCcCCCCCCCCCCCCC-CCCCcccCCCCeeECCCC
Confidence 3456778899999999999888887666778899988899999999999999887776432 224567877888888888
Q ss_pred CccC
Q psy10880 158 MQLY 161 (166)
Q Consensus 158 ~~G~ 161 (166)
|+|.
T Consensus 91 ~~G~ 94 (169)
T 2vj2_A 91 WQGL 94 (169)
T ss_dssp EESS
T ss_pred CCCC
Confidence 8876
|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 166 | ||||
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 4e-06 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 1e-04 | |
| d1d7qa_ | 143 | b.40.4.5 (A:) Translation initiation factor-1a, eI | 0.001 | |
| d1d7qa_ | 143 | b.40.4.5 (A:) Translation initiation factor-1a, eI | 0.001 |
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RPB6/omega subunit-like superfamily: RPB6/omega subunit-like family: RPB6 domain: RPB6 species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.7 bits (98), Expect = 4e-06
Identities = 12/34 (35%), Positives = 24/34 (70%)
Query: 10 MADDDNNDDDDDDDDDDDDDDDDDDDDDDDDDDE 43
M+D+++N D DD DD ++D+ DD ++ +++ E
Sbjct: 1 MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQE 34
|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
| >d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 97.0 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.99 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.96 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.89 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 96.84 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.66 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 96.59 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.56 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.51 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.48 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.47 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.45 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.28 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 96.19 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.13 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.1 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.06 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.95 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.87 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 95.82 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.76 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 95.42 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 94.98 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 94.96 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 94.89 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 94.08 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 93.79 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.3 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 93.06 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 92.82 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 92.74 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 91.85 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 91.66 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.19 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 91.0 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 90.44 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 89.98 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 89.67 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 89.66 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 88.84 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 88.35 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 84.44 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 84.44 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 83.51 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 82.45 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 81.18 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 80.88 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 80.76 |
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: Integrin beta EGF-like domains domain: Integrin beta EGF-like domains species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.00 E-value=0.00015 Score=39.91 Aligned_cols=23 Identities=43% Similarity=1.027 Sum_probs=19.2
Q ss_pred CCcccCCCCCCccCCCCCCCCCCC
Q psy10880 107 FGHYTCSHTGDRKCLPGWSGDYCT 130 (166)
Q Consensus 107 ~ghy~C~~~G~c~C~~GwtG~~C~ 130 (166)
.+|+.| .=|.|+|.+||+|.+|.
T Consensus 6 ~ghG~C-~CG~C~C~~gw~G~~CN 28 (31)
T d1jv2b4 6 SGHGQC-SCGDCLCDSDWTGYYCN 28 (31)
T ss_dssp CCCTTC-CSTTTCCCTTEESSSSC
T ss_pred cCCCcc-cCCceEccCCccccccc
Confidence 357777 56899999999999996
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|