Diaphorina citri psyllid: psy10887


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MKYGFPSLDSLRSFDDFVLSYDRRNRTAYWVFEHLTKENTAYSEAVNRSKSEFFEDDSIHEYFRGRNSDYKYSGYDRGHLAAAGNHKANQKHLDQTFVLSNISPQVGAGFNRDKWAELEKHSRKLLKQYPNVYVCTGPLYLPMKSPNGKKYVNYEVIGDSNVAVPTHFFKIIVAENENGKLVMENYVLPNAVISDSTPLTSFMVSTYLLKCSYIINLLIMFQ
cccccccccccECcccEEEEEcccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEEEEccccCEcccccEEEEEEEcccccEEEEEEEECccccccccccccccccHHHHHHHHccccccccc
MKYGFPSLDSLRSFDDFVLSYDRRNRTAYWVFEHLTKENTAYSEAVNRSKSEFFEDDSIHEYFRGRNSDYKYSGYDRGHLAAAGNHKANQKHLDQTFVLSNISPQVGAGFNRDKWAELEKHSRKLLKQYPNVYVCTGPLYLPMKSPNGKKYVNYEVIGDSNVAVPTHFFKIIVAENENGKLVMENYVLPNAVISDSTPLTSFMVSTYLLKCSYIINLLIMFQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYGFPSLDSLRSFDDFVLSYDRRNRTAYWVFEHLTKENTAYSEAVNRSKSEFFEDDSIHEYFRGRNSDYKYSGYDRGHLAAAGNHKANQKHLDQTFVLSNISPQVGAGFNRDKWAELEKHSRKLLKQYPNVYVCTGPLYLPMKSPNGKKYVNYEVIGDSNVAVPTHFFKIIVAENENGKLVMENYVLPNAVISDSTPLTSFMVSTYLLKCSYIINLLIMFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endonuclease G, mitochondrial Endonuclease important for programmed cell death; it mediates apoptotic DNA fragmentation.confidentQ95NM6
Endonuclease G, mitochondrial Cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, also has ribonuclease (RNase) and RNase H activities. Capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.confidentP38447
Endonuclease G, mitochondrial Cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, also has ribonuclease (RNase) and RNase H activities. Capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.confidentO08600

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006309 [BP]apoptotic DNA fragmentationprobableGO:0006921, GO:0097194, GO:0090304, GO:0090305, GO:0034641, GO:0030262, GO:0007569, GO:0044699, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071840, GO:0016043, GO:0006308, GO:0008150, GO:0071704, GO:1901360, GO:0010259, GO:0009987, GO:0044238, GO:0006915, GO:0006725, GO:0046700, GO:0006259, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0012501, GO:0000737, GO:0044237, GO:0043170, GO:0006807, GO:0019439, GO:0022411
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0004521 [MF]endoribonuclease activityprobableGO:0016787, GO:0004518, GO:0004519, GO:0004540, GO:0016788, GO:0003824, GO:0003674
GO:0004520 [MF]endodeoxyribonuclease activityprobableGO:0016787, GO:0004536, GO:0004519, GO:0016788, GO:0003824, GO:0003674, GO:0004518
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006401 [BP]RNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0000001 [BP]mitochondrion inheritanceprobableGO:0006996, GO:0044699, GO:0048311, GO:0048308, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0007005, GO:0051646, GO:0008150, GO:0051179, GO:0051640, GO:0051641
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0046677 [BP]response to antibioticprobableGO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0004529 [MF]exodeoxyribonuclease activityprobableGO:0016787, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0003674
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008219 [BP]cell deathprobableGO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0034612 [BP]response to tumor necrosis factorprobableGO:0042221, GO:0050896, GO:0008150, GO:0034097, GO:0010033

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S5B, chain A
Confidence level:very confident
Coverage over the Query: 1-221
View the alignment between query and template
View the model in PyMOL