Diaphorina citri psyllid: psy10896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MKPQESLSELSRALCPKSLLYLQINIVWSDWFTAEALHIAHLMASHGYLFPIEEHVLTVKNDNTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLALLQKMFSRKWEFIFMQAEAQSKVDKKRDKLERKVLDSQERAFWDVHRPMPGCINTTEVDMKKVDTKKNKTSSTIKTMKSDLSSTCVSHLEAIKKEITSLKIYINYYEQYCEYDPFFTPTELANPWLTDNPEFWDEEKQAKEISARRIKRWAFSLQELLKDPLGRDHFTKFLDKEFSGENLKFWEAVQEYT
ccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHccCEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHccHHcHHHHHHHHHHHcccHHHHHHHHHHHcc
******L*ELSRALCPKSLLYLQINIVWSDWFTAEALHIAHLMASHGYLFPIEEHVLTVKNDNTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLALLQKMFSRKWEFIFMQAEA***************LDSQERAFWDVHRPMPGCINT******************************VSHLEAIKKEITSLKIYINYYEQYCEYDPFFTPTELANPWLTDNPEFWDEEKQAKEISARRIKRWAFSLQELLKDPLGRDHFTKFLDKEFSGENLKFWEAVQEYT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPQESLSELSRALCPKSLLYLQINIVWSDWFTAEALHIAHLMASHGYLFPIEEHVLTVKNDNTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLALLQKMFSRKWEFIFMQAEAQSKVDKKRDKLERKVLDSQERAFWDVHRPMPGCINTTEVDMKKVDTKKNKTSSTIKTMKSDLSSTCVSHLEAIKKEITSLKIYINYYEQYCEYDPFFTPTELANPWLTDNPEFWDEEKQAKEISARRIKRWAFSLQELLKDPLGRDHFTKFLDKEFSGENLKFWEAVQEYT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulator of G-protein signaling egl-10 Regulates G protein signaling in nervous system.confidentP49809
Regulator of G-protein signaling 7 Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer (By similarity). May play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations. May play a role in synaptic vesicle exocytosis.confidentP49803
Regulator of G-protein signaling 7 Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. May play a role in synaptic vesicle exocytosis. May play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations.confidentP49802

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partconfidentGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044292 [CC]dendrite terminusprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005834 [CC]heterotrimeric G-protein complexprobableGO:0043234, GO:0019897, GO:0032991, GO:0016020, GO:0044464, GO:0009898, GO:0019898, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0005622, GO:0044459, GO:0031234
GO:0045666 [BP]positive regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0005096 [MF]GTPase activator activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0008047, GO:0003674
GO:0007631 [BP]feeding behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0043547 [BP]positive regulation of GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0043087, GO:0050789, GO:0043085, GO:0031329, GO:0051345, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0033121, GO:0033124, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0007622 [BP]rhythmic behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610, GO:0048511
GO:0046662 [BP]regulation of ovipositionprobableGO:2000241, GO:0048583, GO:0050795, GO:0043900, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0007212 [BP]dopamine receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0038032 [BP]termination of G-protein coupled receptor signaling pathwayprobableGO:0009968, GO:0023021, GO:0048585, GO:0023051, GO:0048583, GO:0045744, GO:0050794, GO:0008150, GO:0023057, GO:0008277, GO:0065007, GO:0010648, GO:0009966, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0040017 [BP]positive regulation of locomotionprobableGO:0048518, GO:0008150, GO:0040012, GO:0065007, GO:0050789
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0031681 [MF]G-protein beta-subunit bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain A
Confidence level:very confident
Coverage over the Query: 14-178,194-302
View the alignment between query and template
View the model in PyMOL